SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446471.Xcel_1428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446471.Xcel_1428
Domain Number 1 Region: 83-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000523
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  446471.Xcel_1428
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0209
Family Clc chloride channel 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446471.Xcel_1428
Sequence length 152
Comment (Xylanimonas cellulosilytica DSM 15894)
Sequence
MDWLWWVGAAFALGIVEIIILDVVVLMLIGGALAGALAAALGAPIWVQVVVACVTSVLLV
VTLRPWLLRQLRKRVPLTETNAAAQVGRRAVVVAEVSEAGGRVKLGGEVWTARLDDDGLP
GSPVLAVGAEVQVLRIDGATAVVAPVNAPSAT
Download sequence
Identical sequences D1BRW7
gi|269956228|ref|YP_003326017.1| WP_012878201.1.53538 446471.Xcel_1428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]