SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 447217.AnaeK_0043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  447217.AnaeK_0043
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 447217.AnaeK_0043
Sequence length 162
Comment (Anaeromyxobacter K)
Sequence
MPSRTVNVVVAGLGGQGVIKASEILADAAFRAGLDVKKAEVHGMSQRGGSVTTDVRFGAE
VLSPMVPAGEADFLLVLAPSELEVTRPLLRPGGLLIPPDAVDEARLPNRRSLNVALLGLL
SHHLELDEAHWLAAIHAALPERLHAVNDAAFRLGRETAAAAR
Download sequence
Identical sequences B4UKJ5
WP_012524124.1.49349 gi|197120464|ref|YP_002132415.1| 447217.AnaeK_0043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]