SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 447217.AnaeK_0130 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  447217.AnaeK_0130
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.54e-33
Family GHMP Kinase, N-terminal domain 0.0000963
Further Details:      
 
Domain Number 2 Region: 161-270
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000000000197
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 447217.AnaeK_0130
Sequence length 313
Comment (Anaeromyxobacter K)
Sequence
MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRVSARPGPVRCTVPGRP
ELDGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGSSDAAAVLRCLARALRV
RDGAALAALALEIGSDVPFFLGPGPAWAAGRGERLSRAEVPPLDLVLVYPADPSLAIRAG
DAYRWLDEARASGSQAPRRLGRPGRWRPTLLGNDLQAPCVARKPALQALLGLLVGAGATA
AIMSGSGPTVFGIFPGRGAARGAALAIQGRAKGGAAGVQVLLARTVRRHPRVSPWRSPRS
ASSRSTRRSSRPT
Download sequence
Identical sequences B4ULC6
447217.AnaeK_0130 WP_012524209.1.49349 gi|197120551|ref|YP_002132502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]