SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 447217.AnaeK_0883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  447217.AnaeK_0883
Domain Number - Region: 43-85
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0759
Family NfeD domain-like 0.0099
Further Details:      
 
Domain Number - Region: 181-251
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0857
Family Anticodon-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 447217.AnaeK_0883
Sequence length 270
Comment (Anaeromyxobacter K)
Sequence
MRRLSVVLLSALAVAGCKKQQPPPPQQPAAAQPAGAPAAPVAGKVLERLDAPPYVYLKLQ
TASGDAWAAVPQSDVKVGAEVSIVGAMPMNGFESKTLQRKFDVVYFGTLGGGEAAAAPAG
MPGMGGAAPAGMPPGMGGGMGGGAQPDMAAQHAAAAAGPTEVGDVKVPKASGTDARTVAE
VHAQKVTLKEKPVTIRGKVVKYNEGIMGKNWLHLRDGSGTAGKDNDLTVTTTDRTSVGEV
VTVKGTVRVDKDFGAGYAYPVIVEDAKVAK
Download sequence
Identical sequences B4UF09
WP_012524946.1.49349 447217.AnaeK_0883 gi|197121297|ref|YP_002133248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]