SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 447217.AnaeK_1916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  447217.AnaeK_1916
Domain Number 1 Region: 237-501
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.3e-60
Family PFOR Pyr module 0.078
Further Details:      
 
Domain Number 2 Region: 15-215
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.45e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0094
Further Details:      
 
Domain Number 3 Region: 511-617
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000171
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 447217.AnaeK_1916
Sequence length 619
Comment (Anaeromyxobacter K)
Sequence
MSTQTAKHKVEQVETVTIRFVGDSGDGMQLTGTEFTKANALAGNDLATFPDYPAEIRAPA
GSLFGVSGFQLSFGANEVLTPGDQPDVLVAMNPAALKTNLADLRHGGMLIVNAGAFTESN
LEKANYKSNPLEDPALQSNYRVVLVDMNKLTEAALEGTGLSSKEVARCKNFFALGLMYWL
YSRPIDPQLASIKRKFAKKPEFADANAKVFMAGHVFGETSELFHERYQVPASKLAPGTYR
NVTGNFATALGFATVAQLTGRTVFLGSYPITPATEILQEMAKFKEYGVVTYQAEDEIAGI
GSAIGAAFGGALACTSTSGPGLALKSEMMGLAVITELPLVIVDVQRGGPSTGMPTKTEQA
DLLQALFGRHGESPMPVIAAQSAADCFWSAIEAMKIATKWMTPVLLLTDGYLANGSEPFR
VPSPDELPELKVKYQTEKNYANGTQYMPYLRDAKLIRPWAIPGTAGLEHRVGGLEKDALS
GMVSYDGNNHEKMVLTRAQKVRNVVEDVPDVEVYGDKRGELLLVSWGGTFGSVRGAAEAL
QAAGKKVSHVHLRWLNPLPKNLGDVLRSFEKVLVPEVNGGQLAFYLRGMFPGVDPLQYNR
INGKPIKIHDLVAKVTEAL
Download sequence
Identical sequences B4UB82
gi|197122322|ref|YP_002134273.1| 447217.AnaeK_1916 WP_012525958.1.49349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]