SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 448385.sce5334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce5334
Domain Number 1 Region: 91-154
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000981
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 448385.sce5334
Sequence length 157
Comment (Sorangium cellulosum So ce 56 )
Sequence
MTPALLVVALLVAGLVLLAIEVLVIPGVGLVGLLGGAAVLGAVALAWVALGIGYGLLALG
AGVCVTGLLFWAVPRTPVGRKMVLLETQRSGRGPDARLAALAGKEGRALTPLRPAGTVEI
EDRAVDVVTDGLYVEAGTPVRVASVEGNRVVVEPRKP
Download sequence
Identical sequences A9FXB1
WP_012237965.1.90317 448385.sce5334 gi|162453610|ref|YP_001615977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]