SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 448385.sce5335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce5335
Domain Number 1 Region: 63-233
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.44e-19
Family Crotonase-like 0.066
Further Details:      
 
Weak hits

Sequence:  448385.sce5335
Domain Number - Region: 436-492
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000106
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 448385.sce5335
Sequence length 502
Comment (Sorangium cellulosum So ce 56 )
Sequence
MTGLLRLLEQAARWARRATPLLALLATMALCLPARGEAAAPAAVPGSAAGAPAPPGPRPL
PPIPGAGKVTVVAISGTIDLGLSPFLERVVAAQGEGDLLVLDISTLGGRIDAALAIRDAL
LRARVRTVCWVNPRAISAGALISLACDVIAVAPGATLGAATPVQLGEGGEMKPVAEKVVS
YMRKEMRATAEAKGRRGDIAEAMVDADVEVPGLDEKGKLLTLDGAQALAWGVAEVQAGSE
ADLFGALGRPQPAEIIRPRPSFAEELARFLSDPTLSGVLMTLGMLGILLELYAPGHGVPL
AVGLSCLALFFFGHHVVKLAGWEELALFAVGAILIAVEILVPGHIVPGVAGAACVASALL
LSLLDLERVPVDVAWHAGWLPRALASVCGSLAATAALAVGAARVAPRTRLGRRFVLDAAI
RGVAVGGPPEGPAAPASLVGRLGTAATDLRPSGKVALDGRRVEALSELGYVEAGARVRVI
RAEGGRVVVRAVARSADEERGA
Download sequence
Identical sequences A9FXB4
gi|162453611|ref|YP_001615978.1| 448385.sce5335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]