SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 448385.sce7698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce7698
Domain Number 1 Region: 138-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.4e-115
Family Enolase 0.0000000309
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.62e-55
Family Enolase N-terminal domain-like 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 448385.sce7698
Sequence length 431
Comment (Sorangium cellulosum So ce 56 )
Sequence
MSEIQSVIAREVIDSRGNPTVEAEVTTLSGTGRAAVPSGASTGEHEAVELRDGDKKRFLG
KGVLTAVKNIETVLGPAVLGMDALDQAELDKVLIQADGSPNKSKLGANAILAVSMAAARA
AADTVDLPLWRYLGGAAARVLPTPLMNILNGGVHADNGLEIQEFMIVPYGAESFAEALRT
GAEIFHTLRGLLKKDGMVTAVGDEGGFAPRLPSNRAALEYVVRAIEAAGHRPGEDVGVAL
DSALSEFYDAKTERYTFDKQQKTREEIVAIYDELAKAFPIVSIEDGVAENDEKGWRLLTE
RLGKKVQLVGDDLFVTNPARLAKGIEDGLANAILIKLNQIGTVTETLECIRQAAEGGYRS
IISHRSGETEDTFIADLAVATNAGQIKTGSASRSDRVAKYNQLLRISYALGDGQVFAGRA
PFRRPGAKRSS
Download sequence
Identical sequences A9FA52
gi|162455980|ref|YP_001618347.1| WP_012240306.1.90317 448385.sce7698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]