SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_11910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_11910
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.77e-36
Family Pentapeptide repeats 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_11910
Sequence length 164
Comment (Microcystis aeruginosa NIES 843)
Sequence
MREADLSEAILWGADLSQVDFYRACLRDADLSGANLIEANLEATYLTKAVLNGVNLNSAN
LQQAVLIDTDFRSTSDQRTDLGKTNFCGADLNYANLSGSLLYRANFADCRLCLVNFRASP
ERDGFITDLTGASFRGADLSYADLRGAILEDVDLTDADLTWTLF
Download sequence
Identical sequences B0JSW9
449447.MAE_11910 gi|166363932|ref|YP_001656205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]