SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 450851.PHZ_c0565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  450851.PHZ_c0565
Domain Number 1 Region: 91-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000144
Family NfeD domain-like 0.0048
Further Details:      
 
Weak hits

Sequence:  450851.PHZ_c0565
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0281
Family Protein-L-isoaspartyl O-methyltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 450851.PHZ_c0565
Sequence length 155
Comment (Phenylobacterium zucineum HLK1)
Sequence
MQLLGDIYAAQPFWIWVALAAGLLAIEIMTGTGWLLWAAASAGAVAIATAIGDLSFAMAL
LVFAALTIASSLLARRYLPRSVMAAGGDINDNVDRLVGRRGSAVHAFKGGAGRVFIDGKE
WPAELEDGERLEAGASVEVVGVTGVHLRVRRAGQA
Download sequence
Identical sequences B4REZ1
gi|197104031|ref|YP_002129408.1| WP_012521127.1.63133 450851.PHZ_c0565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]