SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 450851.PHZ_c2014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  450851.PHZ_c2014
Domain Number 1 Region: 123-329
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-49
Family D-glucarate dehydratase-like 0.0000483
Further Details:      
 
Domain Number 2 Region: 12-118
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.36e-20
Family Enolase N-terminal domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 450851.PHZ_c2014
Sequence length 336
Comment (Phenylobacterium zucineum HLK1)
Sequence
MTALRQRLALSVAEEPVALAEPFRITGYVFTEMPVVVVRLRQGAAEGQGEASGVYYLGDD
VPAMLAAIEAARPRIEAGIDREALRRAMPPGGGRNAVDAALWDLEAKLTGRPAWALAGLD
PPKPLVTTFTVGAADPDVMARKAVAYAQARALKLKLTGEAELDAERVRAVRAARPDVWLA
VDANQGFVPDTLERLMPALVDTRVQLLEQPFARGRESDMEGLGSPIPVAADESVLSFADL
EEMVGRFDVVNIKLDKCGGLTEGLAMARQARRLGLGVMVGNMVGTSLAMGPAYLLGQLCE
VVDLDGPIFITRDRLPSVSYADGLIAYPEHGWGSAP
Download sequence
Identical sequences B4RDZ2
WP_012522567.1.63133 450851.PHZ_c2014 gi|197105477|ref|YP_002130854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]