SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 451515.SAUSA300_1534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  451515.SAUSA300_1534
Domain Number 1 Region: 163-226
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000667
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 451515.SAUSA300_1534
Sequence length 227
Comment (Staphylococcus aureus USA300 FPR3757)
Sequence
MTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGIIATLSLLI
LFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTLGDNLLFML
ANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHLVGKTAQTV
TDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
Download sequence
Identical sequences A0A0H2XE66 A0A133PY21 A0A1E5JDZ2 A0A1E8X1U9 Q2FXZ8
WP_001802667.1.100013 WP_001802667.1.100041 WP_001802667.1.100049 WP_001802667.1.100057 WP_001802667.1.10006 WP_001802667.1.100067 WP_001802667.1.100072 WP_001802667.1.100075 WP_001802667.1.100084 WP_001802667.1.100088 WP_001802667.1.100094 WP_001802667.1.100096 WP_001802667.1.100122 WP_001802667.1.10014 WP_001802667.1.100154 WP_001802667.1.100171 WP_001802667.1.100180 WP_001802667.1.100184 WP_001802667.1.100189 WP_001802667.1.100235 WP_001802667.1.100265 WP_001802667.1.100272 WP_001802667.1.100298 WP_001802667.1.100307 WP_001802667.1.100310 WP_001802667.1.10032 WP_001802667.1.100335 WP_001802667.1.100347 WP_001802667.1.100352 WP_001802667.1.100366 WP_001802667.1.100384 WP_001802667.1.100391 WP_001802667.1.100399 WP_001802667.1.10041 WP_001802667.1.100452 WP_001802667.1.10046 WP_001802667.1.100464 WP_001802667.1.10050 WP_001802667.1.100507 WP_001802667.1.100527 WP_001802667.1.10053 WP_001802667.1.100534 WP_001802667.1.100535 WP_001802667.1.100551 WP_001802667.1.100560 WP_001802667.1.100562 WP_001802667.1.100582 WP_001802667.1.100596 WP_001802667.1.100604 WP_001802667.1.100613 WP_001802667.1.100618 WP_001802667.1.100631 WP_001802667.1.100647 WP_001802667.1.100665 WP_001802667.1.100668 WP_001802667.1.100678 WP_001802667.1.100693 WP_001802667.1.100699 WP_001802667.1.100704 WP_001802667.1.100719 WP_001802667.1.100726 WP_001802667.1.100761 WP_001802667.1.100768 WP_001802667.1.100785 WP_001802667.1.100823 WP_001802667.1.100832 WP_001802667.1.100834 WP_001802667.1.10085 WP_001802667.1.100860 WP_001802667.1.100888 WP_001802667.1.1009 WP_001802667.1.100903 WP_001802667.1.100920 WP_001802667.1.100922 WP_001802667.1.100934 WP_001802667.1.100956 WP_001802667.1.100963 WP_001802667.1.10097 WP_001802667.1.100981 WP_001802667.1.100986 WP_001802667.1.100987 WP_001802667.1.101002 WP_001802667.1.101017 WP_001802667.1.101019 WP_001802667.1.101023 WP_001802667.1.101027 WP_001802667.1.101055 WP_001802667.1.101058 WP_001802667.1.101068 WP_001802667.1.101071 WP_001802667.1.101072 WP_001802667.1.101084 WP_001802667.1.101103 WP_001802667.1.10111 WP_001802667.1.101142 WP_001802667.1.101160 WP_001802667.1.101177 WP_001802667.1.101192 WP_001802667.1.101217 WP_001802667.1.101240 WP_001802667.1.101262 WP_001802667.1.101266 WP_001802667.1.101298 WP_001802667.1.101327 WP_001802667.1.101329 WP_001802667.1.101352 WP_001802667.1.101355 WP_001802667.1.101375 WP_001802667.1.101379 WP_001802667.1.101393 WP_001802667.1.101402 WP_001802667.1.101406 WP_001802667.1.101414 WP_001802667.1.101440 WP_001802667.1.101441 WP_001802667.1.101458 WP_001802667.1.10148 WP_001802667.1.101490 WP_001802667.1.101495 WP_001802667.1.1015 WP_001802667.1.101505 WP_001802667.1.101511 WP_001802667.1.101531 WP_001802667.1.101566 WP_001802667.1.101567 WP_001802667.1.101570 WP_001802667.1.101598 WP_001802667.1.101615 WP_001802667.1.101617 WP_001802667.1.101619 WP_001802667.1.101627 WP_001802667.1.101645 WP_001802667.1.10165 WP_001802667.1.101657 WP_001802667.1.10166 WP_001802667.1.101661 WP_001802667.1.101670 WP_001802667.1.101691 WP_001802667.1.101704 WP_001802667.1.101716 WP_001802667.1.101725 WP_001802667.1.101728 WP_001802667.1.101731 WP_001802667.1.101745 WP_001802667.1.101757 WP_001802667.1.101758 WP_001802667.1.101775 WP_001802667.1.101778 WP_001802667.1.101779 WP_001802667.1.101788 WP_001802667.1.101813 WP_001802667.1.101820 WP_001802667.1.101821 WP_001802667.1.101824 WP_001802667.1.101825 WP_001802667.1.101831 WP_001802667.1.101852 WP_001802667.1.101902 WP_001802667.1.101906 WP_001802667.1.101921 WP_001802667.1.101922 WP_001802667.1.101943 WP_001802667.1.101950 WP_001802667.1.101999 WP_001802667.1.102064 WP_001802667.1.102065 WP_001802667.1.102066 WP_001802667.1.102070 WP_001802667.1.102084 WP_001802667.1.10209 WP_001802667.1.102096 WP_001802667.1.102123 WP_001802667.1.102126 WP_001802667.1.102130 WP_001802667.1.102132 WP_001802667.1.10214 WP_001802667.1.1022 WP_001802667.1.10232 WP_001802667.1.10238 WP_001802667.1.10240 WP_001802667.1.10244 WP_001802667.1.10249 WP_001802667.1.1025 WP_001802667.1.10274 WP_001802667.1.10292 WP_001802667.1.10294 WP_001802667.1.10301 WP_001802667.1.10306 WP_001802667.1.10308 WP_001802667.1.1031 WP_001802667.1.10321 WP_001802667.1.10343 WP_001802667.1.10358 WP_001802667.1.10397 WP_001802667.1.1043 WP_001802667.1.10431 WP_001802667.1.10436 WP_001802667.1.10450 WP_001802667.1.10469 WP_001802667.1.10478 WP_001802667.1.10481 WP_001802667.1.10486 WP_001802667.1.10503 WP_001802667.1.1052 WP_001802667.1.10526 WP_001802667.1.10542 WP_001802667.1.10543 WP_001802667.1.10565 WP_001802667.1.10583 WP_001802667.1.1060 WP_001802667.1.10614 WP_001802667.1.10617 WP_001802667.1.10624 WP_001802667.1.10644 WP_001802667.1.10664 WP_001802667.1.10679 WP_001802667.1.10707 WP_001802667.1.10726 WP_001802667.1.10742 WP_001802667.1.10749 WP_001802667.1.10751 WP_001802667.1.10785 WP_001802667.1.10823 WP_001802667.1.10841 WP_001802667.1.10843 WP_001802667.1.10858 WP_001802667.1.1087 WP_001802667.1.10917 WP_001802667.1.10919 WP_001802667.1.10928 WP_001802667.1.10942 WP_001802667.1.10950 WP_001802667.1.10965 WP_001802667.1.10969 WP_001802667.1.1097 WP_001802667.1.10976 WP_001802667.1.10979 WP_001802667.1.10985 WP_001802667.1.10986 WP_001802667.1.11001 WP_001802667.1.11067 WP_001802667.1.11069 WP_001802667.1.11073 WP_001802667.1.11074 WP_001802667.1.11076 WP_001802667.1.11083 WP_001802667.1.11084 WP_001802667.1.11129 WP_001802667.1.1115 WP_001802667.1.11162 WP_001802667.1.11184 WP_001802667.1.11188 WP_001802667.1.1120 WP_001802667.1.11202 WP_001802667.1.11220 WP_001802667.1.11223 WP_001802667.1.11234 WP_001802667.1.1124 WP_001802667.1.11261 WP_001802667.1.11281 WP_001802667.1.11282 WP_001802667.1.11286 WP_001802667.1.11294 WP_001802667.1.11312 WP_001802667.1.11322 WP_001802667.1.11333 WP_001802667.1.11348 WP_001802667.1.11353 WP_001802667.1.1136 WP_001802667.1.11365 WP_001802667.1.11377 WP_001802667.1.11378 WP_001802667.1.11391 WP_001802667.1.11403 WP_001802667.1.11407 WP_001802667.1.11434 WP_001802667.1.11441 WP_001802667.1.11447 WP_001802667.1.11451 WP_001802667.1.11463 WP_001802667.1.1147 WP_001802667.1.11475 WP_001802667.1.11488 WP_001802667.1.11494 WP_001802667.1.11504 WP_001802667.1.1151 WP_001802667.1.11513 WP_001802667.1.1152 WP_001802667.1.11525 WP_001802667.1.11540 WP_001802667.1.11556 WP_001802667.1.11558 WP_001802667.1.11571 WP_001802667.1.11580 WP_001802667.1.11592 WP_001802667.1.11611 WP_001802667.1.11625 WP_001802667.1.11640 WP_001802667.1.11646 WP_001802667.1.11655 WP_001802667.1.11660 WP_001802667.1.11663 WP_001802667.1.11692 WP_001802667.1.117 WP_001802667.1.1171 WP_001802667.1.11719 WP_001802667.1.11720 WP_001802667.1.11723 WP_001802667.1.11730 WP_001802667.1.11736 WP_001802667.1.11741 WP_001802667.1.11768 WP_001802667.1.11781 WP_001802667.1.11794 WP_001802667.1.11795 WP_001802667.1.11816 WP_001802667.1.11828 WP_001802667.1.11829 WP_001802667.1.11837 WP_001802667.1.11884 WP_001802667.1.11894 WP_001802667.1.11903 WP_001802667.1.11904 WP_001802667.1.11919 WP_001802667.1.11969 WP_001802667.1.11991 WP_001802667.1.12005 WP_001802667.1.12019 WP_001802667.1.12026 WP_001802667.1.12029 WP_001802667.1.12042 WP_001802667.1.1205 WP_001802667.1.12073 WP_001802667.1.12098 WP_001802667.1.1210 WP_001802667.1.12123 WP_001802667.1.1213 WP_001802667.1.12137 WP_001802667.1.12149 WP_001802667.1.12152 WP_001802667.1.12158 WP_001802667.1.12170 WP_001802667.1.12175 WP_001802667.1.12179 WP_001802667.1.12181 WP_001802667.1.12193 WP_001802667.1.12194 WP_001802667.1.12201 WP_001802667.1.12226 WP_001802667.1.12233 WP_001802667.1.12234 WP_001802667.1.12256 WP_001802667.1.12272 WP_001802667.1.12297 WP_001802667.1.12328 WP_001802667.1.12330 WP_001802667.1.12361 WP_001802667.1.12366 WP_001802667.1.12391 WP_001802667.1.12436 WP_001802667.1.12437 WP_001802667.1.12447 WP_001802667.1.12498 WP_001802667.1.12508 WP_001802667.1.12516 WP_001802667.1.1252 WP_001802667.1.1253 WP_001802667.1.12555 WP_001802667.1.1257 WP_001802667.1.12597 WP_001802667.1.12598 WP_001802667.1.12605 WP_001802667.1.12608 WP_001802667.1.12618 WP_001802667.1.12639 WP_001802667.1.12685 WP_001802667.1.12705 WP_001802667.1.12707 WP_001802667.1.12711 WP_001802667.1.12715 WP_001802667.1.12733 WP_001802667.1.12737 WP_001802667.1.1276 WP_001802667.1.12770 WP_001802667.1.12771 WP_001802667.1.12772 WP_001802667.1.12780 WP_001802667.1.12788 WP_001802667.1.12822 WP_001802667.1.12829 WP_001802667.1.12833 WP_001802667.1.12845 WP_001802667.1.12858 WP_001802667.1.12862 WP_001802667.1.12884 WP_001802667.1.12886 WP_001802667.1.12903 WP_001802667.1.12904 WP_001802667.1.12918 WP_001802667.1.12920 WP_001802667.1.12937 WP_001802667.1.12938 WP_001802667.1.12951 WP_001802667.1.12977 WP_001802667.1.13013 WP_001802667.1.13039 WP_001802667.1.13062 WP_001802667.1.13072 WP_001802667.1.13091 WP_001802667.1.13104 WP_001802667.1.13112 WP_001802667.1.13154 WP_001802667.1.13164 WP_001802667.1.13169 WP_001802667.1.13170 WP_001802667.1.13189 WP_001802667.1.13228 WP_001802667.1.13243 WP_001802667.1.13250 WP_001802667.1.13303 WP_001802667.1.13307 WP_001802667.1.13322 WP_001802667.1.13326 WP_001802667.1.13336 WP_001802667.1.13355 WP_001802667.1.13376 WP_001802667.1.13379 WP_001802667.1.13381 WP_001802667.1.13405 WP_001802667.1.13448 WP_001802667.1.13468 WP_001802667.1.1347 WP_001802667.1.13486 WP_001802667.1.13501 WP_001802667.1.13505 WP_001802667.1.13514 WP_001802667.1.13531 WP_001802667.1.13532 WP_001802667.1.1355 WP_001802667.1.13554 WP_001802667.1.13556 WP_001802667.1.13557 WP_001802667.1.13568 WP_001802667.1.13598 WP_001802667.1.13612 WP_001802667.1.13617 WP_001802667.1.13650 WP_001802667.1.13654 WP_001802667.1.13665 WP_001802667.1.13668 WP_001802667.1.13670 WP_001802667.1.13680 WP_001802667.1.13683 WP_001802667.1.13696 WP_001802667.1.13709 WP_001802667.1.13726 WP_001802667.1.13727 WP_001802667.1.13728 WP_001802667.1.13733 WP_001802667.1.13734 WP_001802667.1.1374 WP_001802667.1.1375 WP_001802667.1.13755 WP_001802667.1.13757 WP_001802667.1.13769 WP_001802667.1.13772 WP_001802667.1.13787 WP_001802667.1.13804 WP_001802667.1.13805 WP_001802667.1.13807 WP_001802667.1.13831 WP_001802667.1.13870 WP_001802667.1.13879 WP_001802667.1.13884 WP_001802667.1.13897 WP_001802667.1.13904 WP_001802667.1.13914 WP_001802667.1.13933 WP_001802667.1.13940 WP_001802667.1.13947 WP_001802667.1.13948 WP_001802667.1.13983 WP_001802667.1.13986 WP_001802667.1.13987 WP_001802667.1.14010 WP_001802667.1.14025 WP_001802667.1.14034 WP_001802667.1.14071 WP_001802667.1.14076 WP_001802667.1.14097 WP_001802667.1.14112 WP_001802667.1.14143 WP_001802667.1.14153 WP_001802667.1.14163 WP_001802667.1.14192 WP_001802667.1.1420 WP_001802667.1.14201 WP_001802667.1.14221 WP_001802667.1.14233 WP_001802667.1.1425 WP_001802667.1.1426 WP_001802667.1.14272 WP_001802667.1.14281 WP_001802667.1.1429 WP_001802667.1.14298 WP_001802667.1.14302 WP_001802667.1.14305 WP_001802667.1.14314 WP_001802667.1.14337 WP_001802667.1.14342 WP_001802667.1.14349 WP_001802667.1.14355 WP_001802667.1.14358 WP_001802667.1.14363 WP_001802667.1.14364 WP_001802667.1.14365 WP_001802667.1.14372 WP_001802667.1.14394 WP_001802667.1.14397 WP_001802667.1.14412 WP_001802667.1.14418 WP_001802667.1.14475 WP_001802667.1.14535 WP_001802667.1.14546 WP_001802667.1.1457 WP_001802667.1.14577 WP_001802667.1.14590 WP_001802667.1.14596 WP_001802667.1.14639 WP_001802667.1.14665 WP_001802667.1.14666 WP_001802667.1.1468 WP_001802667.1.14681 WP_001802667.1.14696 WP_001802667.1.147 WP_001802667.1.1471 WP_001802667.1.14729 WP_001802667.1.14734 WP_001802667.1.14744 WP_001802667.1.14747 WP_001802667.1.1477 WP_001802667.1.14770 WP_001802667.1.14774 WP_001802667.1.14782 WP_001802667.1.14787 WP_001802667.1.14790 WP_001802667.1.14809 WP_001802667.1.14823 WP_001802667.1.14825 WP_001802667.1.14846 WP_001802667.1.14866 WP_001802667.1.14868 WP_001802667.1.14869 WP_001802667.1.14874 WP_001802667.1.14888 WP_001802667.1.1490 WP_001802667.1.14902 WP_001802667.1.14924 WP_001802667.1.14967 WP_001802667.1.14970 WP_001802667.1.14987 WP_001802667.1.15000 WP_001802667.1.15015 WP_001802667.1.15022 WP_001802667.1.15029 WP_001802667.1.15039 WP_001802667.1.15091 WP_001802667.1.15098 WP_001802667.1.15108 WP_001802667.1.15150 WP_001802667.1.15173 WP_001802667.1.15182 WP_001802667.1.1520 WP_001802667.1.15201 WP_001802667.1.15206 WP_001802667.1.15228 WP_001802667.1.15234 WP_001802667.1.15241 WP_001802667.1.1525 WP_001802667.1.15255 WP_001802667.1.15263 WP_001802667.1.15268 WP_001802667.1.15269 WP_001802667.1.15278 WP_001802667.1.15294 WP_001802667.1.15296 WP_001802667.1.15329 WP_001802667.1.15399 WP_001802667.1.15403 WP_001802667.1.15421 WP_001802667.1.15438 WP_001802667.1.1545 WP_001802667.1.15478 WP_001802667.1.15489 WP_001802667.1.15505 WP_001802667.1.15519 WP_001802667.1.15524 WP_001802667.1.15532 WP_001802667.1.15533 WP_001802667.1.15544 WP_001802667.1.15546 WP_001802667.1.15554 WP_001802667.1.15572 WP_001802667.1.1558 WP_001802667.1.15590 WP_001802667.1.15591 WP_001802667.1.1562 WP_001802667.1.1564 WP_001802667.1.15641 WP_001802667.1.15679 WP_001802667.1.15687 WP_001802667.1.15691 WP_001802667.1.15706 WP_001802667.1.15712 WP_001802667.1.15722 WP_001802667.1.15753 WP_001802667.1.15785 WP_001802667.1.1579 WP_001802667.1.15812 WP_001802667.1.15818 WP_001802667.1.15819 WP_001802667.1.1583 WP_001802667.1.15838 WP_001802667.1.1586 WP_001802667.1.15883 WP_001802667.1.15888 WP_001802667.1.15892 WP_001802667.1.15897 WP_001802667.1.15898 WP_001802667.1.159 WP_001802667.1.15920 WP_001802667.1.15921 WP_001802667.1.15925 WP_001802667.1.15928 WP_001802667.1.15939 WP_001802667.1.15948 WP_001802667.1.15957 WP_001802667.1.15972 WP_001802667.1.1599 WP_001802667.1.1600 WP_001802667.1.16018 WP_001802667.1.16026 WP_001802667.1.1606 WP_001802667.1.16068 WP_001802667.1.16083 WP_001802667.1.16095 WP_001802667.1.16096 WP_001802667.1.16098 WP_001802667.1.16112 WP_001802667.1.16114 WP_001802667.1.16140 WP_001802667.1.16157 WP_001802667.1.16173 WP_001802667.1.16195 WP_001802667.1.16203 WP_001802667.1.16213 WP_001802667.1.16223 WP_001802667.1.1623 WP_001802667.1.16237 WP_001802667.1.16251 WP_001802667.1.16265 WP_001802667.1.16276 WP_001802667.1.16283 WP_001802667.1.16311 WP_001802667.1.16362 WP_001802667.1.16395 WP_001802667.1.16399 WP_001802667.1.16407 WP_001802667.1.16408 WP_001802667.1.16414 WP_001802667.1.16417 WP_001802667.1.16433 WP_001802667.1.16436 WP_001802667.1.16455 WP_001802667.1.16458 WP_001802667.1.16467 WP_001802667.1.16478 WP_001802667.1.16554 WP_001802667.1.16564 WP_001802667.1.16589 WP_001802667.1.16603 WP_001802667.1.16606 WP_001802667.1.16617 WP_001802667.1.1662 WP_001802667.1.16628 WP_001802667.1.16632 WP_001802667.1.16639 WP_001802667.1.16649 WP_001802667.1.1665 WP_001802667.1.16651 WP_001802667.1.16653 WP_001802667.1.1666 WP_001802667.1.16664 WP_001802667.1.16679 WP_001802667.1.16684 WP_001802667.1.16688 WP_001802667.1.16693 WP_001802667.1.16703 WP_001802667.1.16747 WP_001802667.1.16761 WP_001802667.1.16762 WP_001802667.1.16768 WP_001802667.1.16770 WP_001802667.1.16776 WP_001802667.1.16794 WP_001802667.1.16802 WP_001802667.1.16815 WP_001802667.1.16824 WP_001802667.1.16833 WP_001802667.1.16880 WP_001802667.1.16882 WP_001802667.1.16892 WP_001802667.1.16920 WP_001802667.1.16925 WP_001802667.1.16936 WP_001802667.1.16938 WP_001802667.1.16946 WP_001802667.1.16969 WP_001802667.1.16986 WP_001802667.1.170 WP_001802667.1.17009 WP_001802667.1.17012 WP_001802667.1.17038 WP_001802667.1.17046 WP_001802667.1.17050 WP_001802667.1.17080 WP_001802667.1.17104 WP_001802667.1.17122 WP_001802667.1.17132 WP_001802667.1.17137 WP_001802667.1.17139 WP_001802667.1.17143 WP_001802667.1.17156 WP_001802667.1.17157 WP_001802667.1.17169 WP_001802667.1.17176 WP_001802667.1.17180 WP_001802667.1.17193 WP_001802667.1.17200 WP_001802667.1.17201 WP_001802667.1.17210 WP_001802667.1.17231 WP_001802667.1.17234 WP_001802667.1.17240 WP_001802667.1.17248 WP_001802667.1.17249 WP_001802667.1.1725 WP_001802667.1.17256 WP_001802667.1.17289 WP_001802667.1.1729 WP_001802667.1.17296 WP_001802667.1.17309 WP_001802667.1.17320 WP_001802667.1.17327 WP_001802667.1.1736 WP_001802667.1.1740 WP_001802667.1.1741 WP_001802667.1.17419 WP_001802667.1.17450 WP_001802667.1.17454 WP_001802667.1.17475 WP_001802667.1.17485 WP_001802667.1.1751 WP_001802667.1.17520 WP_001802667.1.17524 WP_001802667.1.17526 WP_001802667.1.17529 WP_001802667.1.17531 WP_001802667.1.1756 WP_001802667.1.17569 WP_001802667.1.17581 WP_001802667.1.17590 WP_001802667.1.17628 WP_001802667.1.17643 WP_001802667.1.1765 WP_001802667.1.17650 WP_001802667.1.17651 WP_001802667.1.17657 WP_001802667.1.17658 WP_001802667.1.17666 WP_001802667.1.17671 WP_001802667.1.17676 WP_001802667.1.1771 WP_001802667.1.17717 WP_001802667.1.17718 WP_001802667.1.17720 WP_001802667.1.17725 WP_001802667.1.17729 WP_001802667.1.17737 WP_001802667.1.17770 WP_001802667.1.17796 WP_001802667.1.17818 WP_001802667.1.17832 WP_001802667.1.17834 WP_001802667.1.17835 WP_001802667.1.17838 WP_001802667.1.17845 WP_001802667.1.17847 WP_001802667.1.17853 WP_001802667.1.17859 WP_001802667.1.1787 WP_001802667.1.17876 WP_001802667.1.17882 WP_001802667.1.17909 WP_001802667.1.17922 WP_001802667.1.17928 WP_001802667.1.17929 WP_001802667.1.17943 WP_001802667.1.17951 WP_001802667.1.17966 WP_001802667.1.17974 WP_001802667.1.17987 WP_001802667.1.18011 WP_001802667.1.18016 WP_001802667.1.18035 WP_001802667.1.18043 WP_001802667.1.18069 WP_001802667.1.18074 WP_001802667.1.18080 WP_001802667.1.18105 WP_001802667.1.18113 WP_001802667.1.18132 WP_001802667.1.18140 WP_001802667.1.18153 WP_001802667.1.18203 WP_001802667.1.18205 WP_001802667.1.18237 WP_001802667.1.18248 WP_001802667.1.18273 WP_001802667.1.18283 WP_001802667.1.18288 WP_001802667.1.1829 WP_001802667.1.18290 WP_001802667.1.18301 WP_001802667.1.18309 WP_001802667.1.18310 WP_001802667.1.18320 WP_001802667.1.18346 WP_001802667.1.1835 WP_001802667.1.18360 WP_001802667.1.18412 WP_001802667.1.18429 WP_001802667.1.18437 WP_001802667.1.18451 WP_001802667.1.18466 WP_001802667.1.1847 WP_001802667.1.18487 WP_001802667.1.1849 WP_001802667.1.18495 WP_001802667.1.18497 WP_001802667.1.185 WP_001802667.1.18504 WP_001802667.1.18506 WP_001802667.1.18507 WP_001802667.1.1851 WP_001802667.1.18516 WP_001802667.1.18526 WP_001802667.1.18527 WP_001802667.1.18529 WP_001802667.1.18538 WP_001802667.1.18539 WP_001802667.1.18545 WP_001802667.1.18560 WP_001802667.1.18562 WP_001802667.1.18566 WP_001802667.1.18570 WP_001802667.1.18591 WP_001802667.1.18605 WP_001802667.1.18611 WP_001802667.1.18627 WP_001802667.1.18632 WP_001802667.1.18656 WP_001802667.1.18658 WP_001802667.1.18668 WP_001802667.1.18679 WP_001802667.1.18719 WP_001802667.1.18741 WP_001802667.1.18758 WP_001802667.1.18763 WP_001802667.1.18774 WP_001802667.1.18777 WP_001802667.1.18779 WP_001802667.1.18792 WP_001802667.1.18799 WP_001802667.1.18809 WP_001802667.1.18818 WP_001802667.1.18819 WP_001802667.1.18830 WP_001802667.1.18834 WP_001802667.1.18836 WP_001802667.1.18870 WP_001802667.1.18879 WP_001802667.1.18882 WP_001802667.1.18918 WP_001802667.1.1892 WP_001802667.1.18938 WP_001802667.1.18963 WP_001802667.1.18965 WP_001802667.1.18968 WP_001802667.1.18974 WP_001802667.1.18987 WP_001802667.1.18996 WP_001802667.1.19009 WP_001802667.1.1901 WP_001802667.1.19014 WP_001802667.1.19022 WP_001802667.1.19027 WP_001802667.1.19052 WP_001802667.1.19082 WP_001802667.1.19102 WP_001802667.1.19109 WP_001802667.1.1911 WP_001802667.1.1912 WP_001802667.1.19149 WP_001802667.1.19179 WP_001802667.1.192 WP_001802667.1.19259 WP_001802667.1.19272 WP_001802667.1.19301 WP_001802667.1.19306 WP_001802667.1.19322 WP_001802667.1.19365 WP_001802667.1.19370 WP_001802667.1.19375 WP_001802667.1.19377 WP_001802667.1.19386 WP_001802667.1.19390 WP_001802667.1.19399 WP_001802667.1.19411 WP_001802667.1.1943 WP_001802667.1.19430 WP_001802667.1.19444 WP_001802667.1.19450 WP_001802667.1.19455 WP_001802667.1.19497 WP_001802667.1.19509 WP_001802667.1.19515 WP_001802667.1.19537 WP_001802667.1.19555 WP_001802667.1.19575 WP_001802667.1.19577 WP_001802667.1.19611 WP_001802667.1.1962 WP_001802667.1.1964 WP_001802667.1.19643 WP_001802667.1.19700 WP_001802667.1.19701 WP_001802667.1.19717 WP_001802667.1.19725 WP_001802667.1.19732 WP_001802667.1.19733 WP_001802667.1.1974 WP_001802667.1.19748 WP_001802667.1.1975 WP_001802667.1.19759 WP_001802667.1.19765 WP_001802667.1.19775 WP_001802667.1.19788 WP_001802667.1.19792 WP_001802667.1.19801 WP_001802667.1.19807 WP_001802667.1.19816 WP_001802667.1.19848 WP_001802667.1.19853 WP_001802667.1.19881 WP_001802667.1.19891 WP_001802667.1.19904 WP_001802667.1.19905 WP_001802667.1.19912 WP_001802667.1.19921 WP_001802667.1.19928 WP_001802667.1.19968 WP_001802667.1.19977 WP_001802667.1.19980 WP_001802667.1.19981 WP_001802667.1.19982 WP_001802667.1.2 WP_001802667.1.20006 WP_001802667.1.20049 WP_001802667.1.20052 WP_001802667.1.20057 WP_001802667.1.2007 WP_001802667.1.20078 WP_001802667.1.2008 WP_001802667.1.20090 WP_001802667.1.20100 WP_001802667.1.20101 WP_001802667.1.2013 WP_001802667.1.20155 WP_001802667.1.20156 WP_001802667.1.20160 WP_001802667.1.20161 WP_001802667.1.20167 WP_001802667.1.20177 WP_001802667.1.20191 WP_001802667.1.20201 WP_001802667.1.20210 WP_001802667.1.20214 WP_001802667.1.20219 WP_001802667.1.20221 WP_001802667.1.20235 WP_001802667.1.20245 WP_001802667.1.2025 WP_001802667.1.20265 WP_001802667.1.2029 WP_001802667.1.20307 WP_001802667.1.20324 WP_001802667.1.20340 WP_001802667.1.20354 WP_001802667.1.20358 WP_001802667.1.20386 WP_001802667.1.20394 WP_001802667.1.20398 WP_001802667.1.20399 WP_001802667.1.20411 WP_001802667.1.20447 WP_001802667.1.20473 WP_001802667.1.20479 WP_001802667.1.20487 WP_001802667.1.20496 WP_001802667.1.20512 WP_001802667.1.20550 WP_001802667.1.20554 WP_001802667.1.20558 WP_001802667.1.2056 WP_001802667.1.20574 WP_001802667.1.20579 WP_001802667.1.20585 WP_001802667.1.20598 WP_001802667.1.20611 WP_001802667.1.20618 WP_001802667.1.20619 WP_001802667.1.20620 WP_001802667.1.20649 WP_001802667.1.20661 WP_001802667.1.20690 WP_001802667.1.20698 WP_001802667.1.20736 WP_001802667.1.20772 WP_001802667.1.2079 WP_001802667.1.20796 WP_001802667.1.20821 WP_001802667.1.20833 WP_001802667.1.20838 WP_001802667.1.20846 WP_001802667.1.20860 WP_001802667.1.20866 WP_001802667.1.20867 WP_001802667.1.20878 WP_001802667.1.20906 WP_001802667.1.20913 WP_001802667.1.20922 WP_001802667.1.20935 WP_001802667.1.20939 WP_001802667.1.20945 WP_001802667.1.20971 WP_001802667.1.20975 WP_001802667.1.20979 WP_001802667.1.21009 WP_001802667.1.21013 WP_001802667.1.21015 WP_001802667.1.21031 WP_001802667.1.21036 WP_001802667.1.21054 WP_001802667.1.21056 WP_001802667.1.21064 WP_001802667.1.21066 WP_001802667.1.21078 WP_001802667.1.21080 WP_001802667.1.21081 WP_001802667.1.21109 WP_001802667.1.21111 WP_001802667.1.21140 WP_001802667.1.21154 WP_001802667.1.21183 WP_001802667.1.2119 WP_001802667.1.21222 WP_001802667.1.21257 WP_001802667.1.21259 WP_001802667.1.21272 WP_001802667.1.2128 WP_001802667.1.2129 WP_001802667.1.21312 WP_001802667.1.21313 WP_001802667.1.21314 WP_001802667.1.21330 WP_001802667.1.21339 WP_001802667.1.2135 WP_001802667.1.21356 WP_001802667.1.21359 WP_001802667.1.21375 WP_001802667.1.21379 WP_001802667.1.21386 WP_001802667.1.21393 WP_001802667.1.21402 WP_001802667.1.21412 WP_001802667.1.21416 WP_001802667.1.21449 WP_001802667.1.21458 WP_001802667.1.21464 WP_001802667.1.21465 WP_001802667.1.21477 WP_001802667.1.21480 WP_001802667.1.21500 WP_001802667.1.21505 WP_001802667.1.21511 WP_001802667.1.21514 WP_001802667.1.2154 WP_001802667.1.21572 WP_001802667.1.21583 WP_001802667.1.21589 WP_001802667.1.2159 WP_001802667.1.2160 WP_001802667.1.21601 WP_001802667.1.21621 WP_001802667.1.21636 WP_001802667.1.21679 WP_001802667.1.21712 WP_001802667.1.21719 WP_001802667.1.21724 WP_001802667.1.21746 WP_001802667.1.21763 WP_001802667.1.2178 WP_001802667.1.21787 WP_001802667.1.21820 WP_001802667.1.21828 WP_001802667.1.21830 WP_001802667.1.21890 WP_001802667.1.21894 WP_001802667.1.21900 WP_001802667.1.21901 WP_001802667.1.21919 WP_001802667.1.21954 WP_001802667.1.21985 WP_001802667.1.21988 WP_001802667.1.2200 WP_001802667.1.22000 WP_001802667.1.22011 WP_001802667.1.22022 WP_001802667.1.22027 WP_001802667.1.22033 WP_001802667.1.22038 WP_001802667.1.22045 WP_001802667.1.22049 WP_001802667.1.22065 WP_001802667.1.22082 WP_001802667.1.22093 WP_001802667.1.2211 WP_001802667.1.22111 WP_001802667.1.22149 WP_001802667.1.22163 WP_001802667.1.22164 WP_001802667.1.22165 WP_001802667.1.22170 WP_001802667.1.22174 WP_001802667.1.22177 WP_001802667.1.22180 WP_001802667.1.22197 WP_001802667.1.22200 WP_001802667.1.22227 WP_001802667.1.22246 WP_001802667.1.22259 WP_001802667.1.22302 WP_001802667.1.22307 WP_001802667.1.22344 WP_001802667.1.22351 WP_001802667.1.22367 WP_001802667.1.22369 WP_001802667.1.22400 WP_001802667.1.22418 WP_001802667.1.22419 WP_001802667.1.22426 WP_001802667.1.22441 WP_001802667.1.22493 WP_001802667.1.22498 WP_001802667.1.22512 WP_001802667.1.22526 WP_001802667.1.22531 WP_001802667.1.22533 WP_001802667.1.22547 WP_001802667.1.22551 WP_001802667.1.22559 WP_001802667.1.22650 WP_001802667.1.22657 WP_001802667.1.22684 WP_001802667.1.22696 WP_001802667.1.22702 WP_001802667.1.22709 WP_001802667.1.22714 WP_001802667.1.22727 WP_001802667.1.22730 WP_001802667.1.22731 WP_001802667.1.22738 WP_001802667.1.22739 WP_001802667.1.22764 WP_001802667.1.22787 WP_001802667.1.22789 WP_001802667.1.22790 WP_001802667.1.22792 WP_001802667.1.2280 WP_001802667.1.22803 WP_001802667.1.22808 WP_001802667.1.22811 WP_001802667.1.22826 WP_001802667.1.22843 WP_001802667.1.22853 WP_001802667.1.22861 WP_001802667.1.22869 WP_001802667.1.22890 WP_001802667.1.22969 WP_001802667.1.22975 WP_001802667.1.22983 WP_001802667.1.22984 WP_001802667.1.22994 WP_001802667.1.23004 WP_001802667.1.23008 WP_001802667.1.23012 WP_001802667.1.23048 WP_001802667.1.23061 WP_001802667.1.23069 WP_001802667.1.23082 WP_001802667.1.23103 WP_001802667.1.23121 WP_001802667.1.23130 WP_001802667.1.23132 WP_001802667.1.23133 WP_001802667.1.23146 WP_001802667.1.23152 WP_001802667.1.23161 WP_001802667.1.23185 WP_001802667.1.23194 WP_001802667.1.23197 WP_001802667.1.23217 WP_001802667.1.23222 WP_001802667.1.23228 WP_001802667.1.23238 WP_001802667.1.23244 WP_001802667.1.23251 WP_001802667.1.2327 WP_001802667.1.23275 WP_001802667.1.23304 WP_001802667.1.23381 WP_001802667.1.23413 WP_001802667.1.23420 WP_001802667.1.23431 WP_001802667.1.23439 WP_001802667.1.23449 WP_001802667.1.23450 WP_001802667.1.23476 WP_001802667.1.23491 WP_001802667.1.23516 WP_001802667.1.23517 WP_001802667.1.23531 WP_001802667.1.23541 WP_001802667.1.23544 WP_001802667.1.23557 WP_001802667.1.23568 WP_001802667.1.23572 WP_001802667.1.23580 WP_001802667.1.23586 WP_001802667.1.23613 WP_001802667.1.23617 WP_001802667.1.23626 WP_001802667.1.23630 WP_001802667.1.23644 WP_001802667.1.23671 WP_001802667.1.23690 WP_001802667.1.23708 WP_001802667.1.23710 WP_001802667.1.23730 WP_001802667.1.23740 WP_001802667.1.23796 WP_001802667.1.23809 WP_001802667.1.2382 WP_001802667.1.23822 WP_001802667.1.23842 WP_001802667.1.23849 WP_001802667.1.23856 WP_001802667.1.2389 WP_001802667.1.23896 WP_001802667.1.23900 WP_001802667.1.23902 WP_001802667.1.23907 WP_001802667.1.23926 WP_001802667.1.23935 WP_001802667.1.23944 WP_001802667.1.23956 WP_001802667.1.23972 WP_001802667.1.23995 WP_001802667.1.23998 WP_001802667.1.24000 WP_001802667.1.24081 WP_001802667.1.24129 WP_001802667.1.24154 WP_001802667.1.24167 WP_001802667.1.24174 WP_001802667.1.2420 WP_001802667.1.24207 WP_001802667.1.24213 WP_001802667.1.24226 WP_001802667.1.2423 WP_001802667.1.24241 WP_001802667.1.24263 WP_001802667.1.2427 WP_001802667.1.24275 WP_001802667.1.24276 WP_001802667.1.24277 WP_001802667.1.24279 WP_001802667.1.24286 WP_001802667.1.24302 WP_001802667.1.2434 WP_001802667.1.24343 WP_001802667.1.24347 WP_001802667.1.24364 WP_001802667.1.24365 WP_001802667.1.24388 WP_001802667.1.24416 WP_001802667.1.24418 WP_001802667.1.2442 WP_001802667.1.24436 WP_001802667.1.24437 WP_001802667.1.24439 WP_001802667.1.24443 WP_001802667.1.24462 WP_001802667.1.24478 WP_001802667.1.2450 WP_001802667.1.24502 WP_001802667.1.24503 WP_001802667.1.24516 WP_001802667.1.24519 WP_001802667.1.24569 WP_001802667.1.24572 WP_001802667.1.2458 WP_001802667.1.24589 WP_001802667.1.24596 WP_001802667.1.24597 WP_001802667.1.24602 WP_001802667.1.24617 WP_001802667.1.24625 WP_001802667.1.24631 WP_001802667.1.24644 WP_001802667.1.24654 WP_001802667.1.24674 WP_001802667.1.24679 WP_001802667.1.24681 WP_001802667.1.24684 WP_001802667.1.24685 WP_001802667.1.24702 WP_001802667.1.24711 WP_001802667.1.24714 WP_001802667.1.24745 WP_001802667.1.24781 WP_001802667.1.2480 WP_001802667.1.24802 WP_001802667.1.24817 WP_001802667.1.24823 WP_001802667.1.24834 WP_001802667.1.24855 WP_001802667.1.24856 WP_001802667.1.24891 WP_001802667.1.24903 WP_001802667.1.24918 WP_001802667.1.24937 WP_001802667.1.2497 WP_001802667.1.24996 WP_001802667.1.25001 WP_001802667.1.25007 WP_001802667.1.2501 WP_001802667.1.25012 WP_001802667.1.25029 WP_001802667.1.2506 WP_001802667.1.25070 WP_001802667.1.25083 WP_001802667.1.25092 WP_001802667.1.25095 WP_001802667.1.25098 WP_001802667.1.25115 WP_001802667.1.25117 WP_001802667.1.25120 WP_001802667.1.25145 WP_001802667.1.25167 WP_001802667.1.25170 WP_001802667.1.25187 WP_001802667.1.25209 WP_001802667.1.25216 WP_001802667.1.2522 WP_001802667.1.25221 WP_001802667.1.25262 WP_001802667.1.25287 WP_001802667.1.25288 WP_001802667.1.25341 WP_001802667.1.25345 WP_001802667.1.25361 WP_001802667.1.25433 WP_001802667.1.25438 WP_001802667.1.2544 WP_001802667.1.25459 WP_001802667.1.25469 WP_001802667.1.25479 WP_001802667.1.25488 WP_001802667.1.25489 WP_001802667.1.25495 WP_001802667.1.25511 WP_001802667.1.2552 WP_001802667.1.25557 WP_001802667.1.25567 WP_001802667.1.25569 WP_001802667.1.25591 WP_001802667.1.25593 WP_001802667.1.25595 WP_001802667.1.25597 WP_001802667.1.25621 WP_001802667.1.25623 WP_001802667.1.25633 WP_001802667.1.25634 WP_001802667.1.25651 WP_001802667.1.257 WP_001802667.1.25721 WP_001802667.1.25732 WP_001802667.1.25737 WP_001802667.1.25744 WP_001802667.1.25758 WP_001802667.1.25770 WP_001802667.1.25772 WP_001802667.1.25776 WP_001802667.1.25779 WP_001802667.1.2579 WP_001802667.1.25801 WP_001802667.1.25802 WP_001802667.1.25820 WP_001802667.1.25840 WP_001802667.1.25852 WP_001802667.1.25856 WP_001802667.1.25857 WP_001802667.1.25868 WP_001802667.1.25881 WP_001802667.1.25891 WP_001802667.1.2590 WP_001802667.1.25910 WP_001802667.1.25924 WP_001802667.1.25929 WP_001802667.1.2593 WP_001802667.1.25930 WP_001802667.1.25955 WP_001802667.1.25984 WP_001802667.1.26006 WP_001802667.1.26012 WP_001802667.1.26015 WP_001802667.1.26033 WP_001802667.1.26039 WP_001802667.1.26050 WP_001802667.1.26058 WP_001802667.1.2608 WP_001802667.1.26086 WP_001802667.1.26094 WP_001802667.1.26106 WP_001802667.1.26143 WP_001802667.1.26169 WP_001802667.1.26172 WP_001802667.1.2619 WP_001802667.1.2621 WP_001802667.1.26225 WP_001802667.1.26226 WP_001802667.1.26255 WP_001802667.1.26266 WP_001802667.1.26271 WP_001802667.1.26276 WP_001802667.1.26283 WP_001802667.1.26289 WP_001802667.1.26290 WP_001802667.1.26293 WP_001802667.1.26298 WP_001802667.1.26306 WP_001802667.1.26307 WP_001802667.1.26314 WP_001802667.1.26315 WP_001802667.1.26318 WP_001802667.1.2633 WP_001802667.1.26340 WP_001802667.1.26345 WP_001802667.1.26346 WP_001802667.1.26354 WP_001802667.1.26359 WP_001802667.1.26364 WP_001802667.1.26370 WP_001802667.1.26397 WP_001802667.1.26399 WP_001802667.1.26404 WP_001802667.1.26405 WP_001802667.1.26424 WP_001802667.1.2643 WP_001802667.1.26431 WP_001802667.1.2645 WP_001802667.1.26481 WP_001802667.1.26506 WP_001802667.1.26533 WP_001802667.1.26555 WP_001802667.1.2656 WP_001802667.1.2658 WP_001802667.1.26584 WP_001802667.1.2661 WP_001802667.1.26626 WP_001802667.1.2664 WP_001802667.1.26650 WP_001802667.1.26662 WP_001802667.1.26663 WP_001802667.1.26664 WP_001802667.1.26677 WP_001802667.1.26692 WP_001802667.1.26713 WP_001802667.1.26726 WP_001802667.1.2673 WP_001802667.1.26733 WP_001802667.1.2674 WP_001802667.1.26749 WP_001802667.1.26751 WP_001802667.1.26771 WP_001802667.1.26772 WP_001802667.1.26773 WP_001802667.1.26778 WP_001802667.1.26790 WP_001802667.1.2680 WP_001802667.1.26804 WP_001802667.1.2684 WP_001802667.1.26840 WP_001802667.1.26850 WP_001802667.1.26864 WP_001802667.1.26865 WP_001802667.1.2687 WP_001802667.1.26884 WP_001802667.1.26886 WP_001802667.1.2689 WP_001802667.1.26903 WP_001802667.1.26905 WP_001802667.1.26927 WP_001802667.1.26929 WP_001802667.1.26938 WP_001802667.1.26944 WP_001802667.1.26947 WP_001802667.1.26958 WP_001802667.1.26963 WP_001802667.1.2697 WP_001802667.1.27013 WP_001802667.1.27053 WP_001802667.1.27080 WP_001802667.1.27083 WP_001802667.1.27097 WP_001802667.1.2710 WP_001802667.1.27120 WP_001802667.1.27127 WP_001802667.1.27147 WP_001802667.1.27154 WP_001802667.1.27160 WP_001802667.1.27166 WP_001802667.1.27168 WP_001802667.1.27170 WP_001802667.1.2718 WP_001802667.1.27182 WP_001802667.1.2719 WP_001802667.1.27207 WP_001802667.1.27226 WP_001802667.1.27237 WP_001802667.1.27246 WP_001802667.1.27262 WP_001802667.1.27293 WP_001802667.1.27294 WP_001802667.1.27303 WP_001802667.1.27311 WP_001802667.1.27323 WP_001802667.1.27333 WP_001802667.1.2734 WP_001802667.1.27345 WP_001802667.1.27379 WP_001802667.1.27384 WP_001802667.1.27387 WP_001802667.1.27413 WP_001802667.1.27415 WP_001802667.1.2744 WP_001802667.1.27447 WP_001802667.1.27448 WP_001802667.1.27455 WP_001802667.1.27456 WP_001802667.1.27457 WP_001802667.1.27467 WP_001802667.1.27468 WP_001802667.1.27489 WP_001802667.1.27516 WP_001802667.1.27529 WP_001802667.1.2753 WP_001802667.1.27539 WP_001802667.1.27551 WP_001802667.1.27562 WP_001802667.1.2759 WP_001802667.1.27590 WP_001802667.1.27605 WP_001802667.1.27608 WP_001802667.1.27614 WP_001802667.1.27615 WP_001802667.1.27621 WP_001802667.1.27622 WP_001802667.1.27628 WP_001802667.1.27640 WP_001802667.1.27646 WP_001802667.1.27654 WP_001802667.1.27662 WP_001802667.1.27667 WP_001802667.1.27670 WP_001802667.1.27673 WP_001802667.1.2768 WP_001802667.1.27689 WP_001802667.1.27696 WP_001802667.1.27717 WP_001802667.1.27720 WP_001802667.1.27739 WP_001802667.1.27744 WP_001802667.1.27748 WP_001802667.1.27765 WP_001802667.1.27787 WP_001802667.1.27793 WP_001802667.1.27799 WP_001802667.1.27817 WP_001802667.1.27830 WP_001802667.1.27834 WP_001802667.1.27854 WP_001802667.1.27929 WP_001802667.1.27950 WP_001802667.1.27953 WP_001802667.1.27972 WP_001802667.1.27999 WP_001802667.1.2800 WP_001802667.1.28007 WP_001802667.1.28016 WP_001802667.1.28025 WP_001802667.1.28063 WP_001802667.1.28071 WP_001802667.1.28074 WP_001802667.1.28079 WP_001802667.1.2808 WP_001802667.1.28081 WP_001802667.1.28088 WP_001802667.1.28091 WP_001802667.1.28105 WP_001802667.1.28107 WP_001802667.1.28117 WP_001802667.1.28138 WP_001802667.1.28147 WP_001802667.1.28158 WP_001802667.1.28173 WP_001802667.1.28191 WP_001802667.1.28207 WP_001802667.1.28213 WP_001802667.1.28226 WP_001802667.1.28230 WP_001802667.1.28253 WP_001802667.1.28257 WP_001802667.1.28274 WP_001802667.1.28298 WP_001802667.1.28315 WP_001802667.1.28319 WP_001802667.1.28334 WP_001802667.1.28336 WP_001802667.1.28337 WP_001802667.1.28347 WP_001802667.1.28358 WP_001802667.1.28360 WP_001802667.1.28376 WP_001802667.1.28381 WP_001802667.1.28388 WP_001802667.1.28392 WP_001802667.1.28394 WP_001802667.1.28399 WP_001802667.1.2840 WP_001802667.1.28400 WP_001802667.1.28426 WP_001802667.1.28430 WP_001802667.1.28447 WP_001802667.1.28477 WP_001802667.1.28482 WP_001802667.1.28490 WP_001802667.1.28498 WP_001802667.1.28501 WP_001802667.1.28502 WP_001802667.1.2852 WP_001802667.1.28526 WP_001802667.1.28527 WP_001802667.1.28532 WP_001802667.1.28564 WP_001802667.1.28578 WP_001802667.1.28580 WP_001802667.1.28584 WP_001802667.1.28605 WP_001802667.1.28614 WP_001802667.1.2862 WP_001802667.1.28629 WP_001802667.1.28636 WP_001802667.1.28650 WP_001802667.1.28652 WP_001802667.1.28672 WP_001802667.1.28675 WP_001802667.1.28690 WP_001802667.1.28691 WP_001802667.1.28710 WP_001802667.1.28720 WP_001802667.1.28763 WP_001802667.1.28784 WP_001802667.1.28785 WP_001802667.1.28825 WP_001802667.1.28833 WP_001802667.1.28848 WP_001802667.1.28862 WP_001802667.1.28866 WP_001802667.1.28871 WP_001802667.1.28874 WP_001802667.1.28887 WP_001802667.1.28909 WP_001802667.1.2891 WP_001802667.1.28915 WP_001802667.1.28925 WP_001802667.1.28933 WP_001802667.1.28934 WP_001802667.1.28960 WP_001802667.1.28970 WP_001802667.1.28981 WP_001802667.1.28987 WP_001802667.1.29052 WP_001802667.1.2906 WP_001802667.1.29060 WP_001802667.1.29090 WP_001802667.1.29091 WP_001802667.1.29107 WP_001802667.1.29110 WP_001802667.1.29112 WP_001802667.1.2913 WP_001802667.1.29155 WP_001802667.1.29166 WP_001802667.1.29170 WP_001802667.1.29187 WP_001802667.1.29188 WP_001802667.1.29207 WP_001802667.1.29226 WP_001802667.1.29242 WP_001802667.1.29243 WP_001802667.1.29244 WP_001802667.1.29250 WP_001802667.1.29263 WP_001802667.1.29272 WP_001802667.1.29276 WP_001802667.1.29282 WP_001802667.1.29285 WP_001802667.1.29301 WP_001802667.1.29312 WP_001802667.1.29315 WP_001802667.1.29329 WP_001802667.1.29340 WP_001802667.1.29366 WP_001802667.1.29368 WP_001802667.1.29372 WP_001802667.1.29373 WP_001802667.1.29375 WP_001802667.1.29381 WP_001802667.1.29395 WP_001802667.1.29420 WP_001802667.1.29433 WP_001802667.1.29445 WP_001802667.1.29453 WP_001802667.1.29468 WP_001802667.1.29479 WP_001802667.1.29483 WP_001802667.1.29484 WP_001802667.1.29511 WP_001802667.1.29522 WP_001802667.1.29541 WP_001802667.1.29553 WP_001802667.1.29554 WP_001802667.1.29561 WP_001802667.1.2957 WP_001802667.1.29571 WP_001802667.1.29596 WP_001802667.1.29644 WP_001802667.1.29676 WP_001802667.1.29692 WP_001802667.1.29709 WP_001802667.1.29710 WP_001802667.1.29716 WP_001802667.1.2972 WP_001802667.1.29731 WP_001802667.1.29736 WP_001802667.1.29744 WP_001802667.1.2975 WP_001802667.1.29758 WP_001802667.1.29781 WP_001802667.1.29788 WP_001802667.1.29805 WP_001802667.1.2981 WP_001802667.1.29826 WP_001802667.1.2983 WP_001802667.1.29862 WP_001802667.1.29885 WP_001802667.1.29902 WP_001802667.1.29905 WP_001802667.1.29918 WP_001802667.1.29963 WP_001802667.1.2997 WP_001802667.1.29981 WP_001802667.1.29982 WP_001802667.1.30012 WP_001802667.1.30023 WP_001802667.1.30033 WP_001802667.1.30047 WP_001802667.1.30051 WP_001802667.1.30057 WP_001802667.1.30089 WP_001802667.1.30095 WP_001802667.1.30100 WP_001802667.1.3012 WP_001802667.1.30130 WP_001802667.1.30150 WP_001802667.1.30152 WP_001802667.1.30154 WP_001802667.1.30159 WP_001802667.1.30169 WP_001802667.1.30176 WP_001802667.1.30186 WP_001802667.1.30188 WP_001802667.1.30190 WP_001802667.1.30191 WP_001802667.1.30197 WP_001802667.1.30203 WP_001802667.1.30204 WP_001802667.1.30209 WP_001802667.1.30230 WP_001802667.1.30249 WP_001802667.1.30262 WP_001802667.1.30268 WP_001802667.1.30274 WP_001802667.1.3029 WP_001802667.1.30294 WP_001802667.1.30302 WP_001802667.1.30307 WP_001802667.1.30328 WP_001802667.1.30350 WP_001802667.1.30364 WP_001802667.1.30367 WP_001802667.1.30376 WP_001802667.1.30381 WP_001802667.1.30392 WP_001802667.1.30418 WP_001802667.1.30422 WP_001802667.1.30458 WP_001802667.1.30477 WP_001802667.1.30482 WP_001802667.1.30496 WP_001802667.1.3050 WP_001802667.1.30508 WP_001802667.1.30530 WP_001802667.1.30531 WP_001802667.1.30560 WP_001802667.1.30566 WP_001802667.1.30568 WP_001802667.1.30600 WP_001802667.1.30622 WP_001802667.1.30623 WP_001802667.1.30645 WP_001802667.1.30646 WP_001802667.1.30648 WP_001802667.1.30650 WP_001802667.1.30652 WP_001802667.1.30666 WP_001802667.1.30668 WP_001802667.1.30690 WP_001802667.1.30702 WP_001802667.1.30720 WP_001802667.1.30726 WP_001802667.1.30758 WP_001802667.1.30763 WP_001802667.1.30768 WP_001802667.1.3077 WP_001802667.1.30779 WP_001802667.1.30845 WP_001802667.1.30846 WP_001802667.1.30847 WP_001802667.1.30854 WP_001802667.1.30861 WP_001802667.1.30862 WP_001802667.1.30863 WP_001802667.1.30874 WP_001802667.1.30878 WP_001802667.1.30880 WP_001802667.1.30889 WP_001802667.1.30907 WP_001802667.1.30911 WP_001802667.1.30915 WP_001802667.1.30916 WP_001802667.1.30928 WP_001802667.1.30945 WP_001802667.1.3097 WP_001802667.1.30970 WP_001802667.1.30971 WP_001802667.1.30998 WP_001802667.1.31005 WP_001802667.1.31022 WP_001802667.1.31037 WP_001802667.1.31039 WP_001802667.1.31041 WP_001802667.1.31048 WP_001802667.1.31065 WP_001802667.1.31068 WP_001802667.1.31077 WP_001802667.1.31091 WP_001802667.1.31113 WP_001802667.1.31114 WP_001802667.1.31120 WP_001802667.1.31123 WP_001802667.1.31124 WP_001802667.1.31176 WP_001802667.1.31194 WP_001802667.1.31202 WP_001802667.1.31204 WP_001802667.1.31206 WP_001802667.1.31212 WP_001802667.1.3123 WP_001802667.1.31232 WP_001802667.1.31278 WP_001802667.1.31294 WP_001802667.1.31315 WP_001802667.1.3132 WP_001802667.1.31337 WP_001802667.1.31339 WP_001802667.1.31355 WP_001802667.1.31363 WP_001802667.1.31376 WP_001802667.1.31402 WP_001802667.1.31424 WP_001802667.1.31426 WP_001802667.1.31436 WP_001802667.1.31437 WP_001802667.1.31441 WP_001802667.1.31442 WP_001802667.1.31462 WP_001802667.1.31468 WP_001802667.1.31478 WP_001802667.1.31479 WP_001802667.1.31484 WP_001802667.1.31497 WP_001802667.1.315 WP_001802667.1.31505 WP_001802667.1.31529 WP_001802667.1.31531 WP_001802667.1.31539 WP_001802667.1.31567 WP_001802667.1.31568 WP_001802667.1.31589 WP_001802667.1.31605 WP_001802667.1.31611 WP_001802667.1.31621 WP_001802667.1.31638 WP_001802667.1.31642 WP_001802667.1.31647 WP_001802667.1.31653 WP_001802667.1.31667 WP_001802667.1.31686 WP_001802667.1.31701 WP_001802667.1.31743 WP_001802667.1.31753 WP_001802667.1.31787 WP_001802667.1.31797 WP_001802667.1.31806 WP_001802667.1.31816 WP_001802667.1.31817 WP_001802667.1.31827 WP_001802667.1.31828 WP_001802667.1.31842 WP_001802667.1.3188 WP_001802667.1.31892 WP_001802667.1.31897 WP_001802667.1.31925 WP_001802667.1.31931 WP_001802667.1.31949 WP_001802667.1.31990 WP_001802667.1.31994 WP_001802667.1.31997 WP_001802667.1.32003 WP_001802667.1.32005 WP_001802667.1.32029 WP_001802667.1.32059 WP_001802667.1.32067 WP_001802667.1.32077 WP_001802667.1.32095 WP_001802667.1.32106 WP_001802667.1.32118 WP_001802667.1.32122 WP_001802667.1.32130 WP_001802667.1.32160 WP_001802667.1.32167 WP_001802667.1.3219 WP_001802667.1.32207 WP_001802667.1.32215 WP_001802667.1.32217 WP_001802667.1.32244 WP_001802667.1.32248 WP_001802667.1.32269 WP_001802667.1.32270 WP_001802667.1.32281 WP_001802667.1.3229 WP_001802667.1.32295 WP_001802667.1.32301 WP_001802667.1.3231 WP_001802667.1.32338 WP_001802667.1.32339 WP_001802667.1.32340 WP_001802667.1.32348 WP_001802667.1.32365 WP_001802667.1.32384 WP_001802667.1.32405 WP_001802667.1.3242 WP_001802667.1.3244 WP_001802667.1.32454 WP_001802667.1.32464 WP_001802667.1.32474 WP_001802667.1.32481 WP_001802667.1.32483 WP_001802667.1.32497 WP_001802667.1.32514 WP_001802667.1.32517 WP_001802667.1.32534 WP_001802667.1.32546 WP_001802667.1.32555 WP_001802667.1.32565 WP_001802667.1.32584 WP_001802667.1.32588 WP_001802667.1.32599 WP_001802667.1.32607 WP_001802667.1.32634 WP_001802667.1.32636 WP_001802667.1.32645 WP_001802667.1.32671 WP_001802667.1.32739 WP_001802667.1.32746 WP_001802667.1.32754 WP_001802667.1.32761 WP_001802667.1.32763 WP_001802667.1.32764 WP_001802667.1.32770 WP_001802667.1.32795 WP_001802667.1.328 WP_001802667.1.32800 WP_001802667.1.32829 WP_001802667.1.32839 WP_001802667.1.32898 WP_001802667.1.32921 WP_001802667.1.32925 WP_001802667.1.32928 WP_001802667.1.3293 WP_001802667.1.32939 WP_001802667.1.32954 WP_001802667.1.32965 WP_001802667.1.32980 WP_001802667.1.32987 WP_001802667.1.3299 WP_001802667.1.3301 WP_001802667.1.33029 WP_001802667.1.33038 WP_001802667.1.33048 WP_001802667.1.3306 WP_001802667.1.33067 WP_001802667.1.33108 WP_001802667.1.33110 WP_001802667.1.33123 WP_001802667.1.33147 WP_001802667.1.3316 WP_001802667.1.33161 WP_001802667.1.33172 WP_001802667.1.33199 WP_001802667.1.33212 WP_001802667.1.33213 WP_001802667.1.33250 WP_001802667.1.33252 WP_001802667.1.33255 WP_001802667.1.33266 WP_001802667.1.33277 WP_001802667.1.33292 WP_001802667.1.33296 WP_001802667.1.3330 WP_001802667.1.33307 WP_001802667.1.33322 WP_001802667.1.33328 WP_001802667.1.33335 WP_001802667.1.3335 WP_001802667.1.33357 WP_001802667.1.33368 WP_001802667.1.33372 WP_001802667.1.3338 WP_001802667.1.33388 WP_001802667.1.33394 WP_001802667.1.3341 WP_001802667.1.33416 WP_001802667.1.3342 WP_001802667.1.33426 WP_001802667.1.3343 WP_001802667.1.33432 WP_001802667.1.3345 WP_001802667.1.33463 WP_001802667.1.33468 WP_001802667.1.3347 WP_001802667.1.33483 WP_001802667.1.33484 WP_001802667.1.33507 WP_001802667.1.33516 WP_001802667.1.33518 WP_001802667.1.33520 WP_001802667.1.33538 WP_001802667.1.33540 WP_001802667.1.33567 WP_001802667.1.3357 WP_001802667.1.33575 WP_001802667.1.3358 WP_001802667.1.33594 WP_001802667.1.33607 WP_001802667.1.33610 WP_001802667.1.33626 WP_001802667.1.33627 WP_001802667.1.3363 WP_001802667.1.33640 WP_001802667.1.33650 WP_001802667.1.33654 WP_001802667.1.33655 WP_001802667.1.33692 WP_001802667.1.33695 WP_001802667.1.33707 WP_001802667.1.33718 WP_001802667.1.33720 WP_001802667.1.33724 WP_001802667.1.33735 WP_001802667.1.33743 WP_001802667.1.33756 WP_001802667.1.33765 WP_001802667.1.33766 WP_001802667.1.33767 WP_001802667.1.33769 WP_001802667.1.33778 WP_001802667.1.33792 WP_001802667.1.33804 WP_001802667.1.33813 WP_001802667.1.33816 WP_001802667.1.33850 WP_001802667.1.33855 WP_001802667.1.33899 WP_001802667.1.33915 WP_001802667.1.33940 WP_001802667.1.33949 WP_001802667.1.33963 WP_001802667.1.33966 WP_001802667.1.33968 WP_001802667.1.33971 WP_001802667.1.33983 WP_001802667.1.33989 WP_001802667.1.33994 WP_001802667.1.34026 WP_001802667.1.34030 WP_001802667.1.34051 WP_001802667.1.34060 WP_001802667.1.34062 WP_001802667.1.34069 WP_001802667.1.34078 WP_001802667.1.34079 WP_001802667.1.34089 WP_001802667.1.34100 WP_001802667.1.34105 WP_001802667.1.34112 WP_001802667.1.34128 WP_001802667.1.34132 WP_001802667.1.3418 WP_001802667.1.34182 WP_001802667.1.34209 WP_001802667.1.3422 WP_001802667.1.34223 WP_001802667.1.34231 WP_001802667.1.34244 WP_001802667.1.34249 WP_001802667.1.34250 WP_001802667.1.34251 WP_001802667.1.34254 WP_001802667.1.34280 WP_001802667.1.34285 WP_001802667.1.34307 WP_001802667.1.34334 WP_001802667.1.34361 WP_001802667.1.34381 WP_001802667.1.34403 WP_001802667.1.34410 WP_001802667.1.3442 WP_001802667.1.34427 WP_001802667.1.34436 WP_001802667.1.34438 WP_001802667.1.34471 WP_001802667.1.34473 WP_001802667.1.3448 WP_001802667.1.34482 WP_001802667.1.34492 WP_001802667.1.34502 WP_001802667.1.34510 WP_001802667.1.34512 WP_001802667.1.34526 WP_001802667.1.34578 WP_001802667.1.3461 WP_001802667.1.34620 WP_001802667.1.34626 WP_001802667.1.34666 WP_001802667.1.34677 WP_001802667.1.34716 WP_001802667.1.34723 WP_001802667.1.34737 WP_001802667.1.3474 WP_001802667.1.34741 WP_001802667.1.34767 WP_001802667.1.34774 WP_001802667.1.34818 WP_001802667.1.34847 WP_001802667.1.34865 WP_001802667.1.34890 WP_001802667.1.34912 WP_001802667.1.34918 WP_001802667.1.34923 WP_001802667.1.34926 WP_001802667.1.34943 WP_001802667.1.34967 WP_001802667.1.34998 WP_001802667.1.35031 WP_001802667.1.35032 WP_001802667.1.35054 WP_001802667.1.35059 WP_001802667.1.35062 WP_001802667.1.35089 WP_001802667.1.35097 WP_001802667.1.35106 WP_001802667.1.35108 WP_001802667.1.35110 WP_001802667.1.35121 WP_001802667.1.35177 WP_001802667.1.35182 WP_001802667.1.35189 WP_001802667.1.35194 WP_001802667.1.35222 WP_001802667.1.35233 WP_001802667.1.35243 WP_001802667.1.35257 WP_001802667.1.3526 WP_001802667.1.35264 WP_001802667.1.35276 WP_001802667.1.35285 WP_001802667.1.35289 WP_001802667.1.35297 WP_001802667.1.35307 WP_001802667.1.35314 WP_001802667.1.35334 WP_001802667.1.35340 WP_001802667.1.35342 WP_001802667.1.35345 WP_001802667.1.35352 WP_001802667.1.35391 WP_001802667.1.354 WP_001802667.1.35413 WP_001802667.1.35415 WP_001802667.1.3542 WP_001802667.1.35423 WP_001802667.1.35433 WP_001802667.1.35435 WP_001802667.1.3547 WP_001802667.1.3549 WP_001802667.1.35490 WP_001802667.1.35497 WP_001802667.1.35498 WP_001802667.1.35506 WP_001802667.1.35508 WP_001802667.1.35517 WP_001802667.1.35519 WP_001802667.1.3552 WP_001802667.1.35525 WP_001802667.1.35549 WP_001802667.1.35580 WP_001802667.1.35623 WP_001802667.1.35642 WP_001802667.1.35659 WP_001802667.1.35661 WP_001802667.1.35673 WP_001802667.1.35686 WP_001802667.1.3569 WP_001802667.1.35696 WP_001802667.1.35730 WP_001802667.1.3574 WP_001802667.1.35742 WP_001802667.1.35746 WP_001802667.1.35774 WP_001802667.1.35784 WP_001802667.1.3579 WP_001802667.1.35794 WP_001802667.1.35799 WP_001802667.1.35801 WP_001802667.1.35826 WP_001802667.1.35837 WP_001802667.1.35888 WP_001802667.1.35890 WP_001802667.1.35900 WP_001802667.1.35928 WP_001802667.1.35933 WP_001802667.1.35950 WP_001802667.1.35958 WP_001802667.1.36004 WP_001802667.1.36021 WP_001802667.1.36041 WP_001802667.1.36082 WP_001802667.1.36093 WP_001802667.1.36102 WP_001802667.1.3611 WP_001802667.1.36117 WP_001802667.1.36119 WP_001802667.1.36141 WP_001802667.1.3617 WP_001802667.1.36175 WP_001802667.1.36176 WP_001802667.1.36179 WP_001802667.1.36187 WP_001802667.1.36188 WP_001802667.1.36193 WP_001802667.1.36208 WP_001802667.1.36211 WP_001802667.1.36220 WP_001802667.1.36223 WP_001802667.1.3623 WP_001802667.1.36231 WP_001802667.1.36249 WP_001802667.1.36250 WP_001802667.1.36264 WP_001802667.1.36278 WP_001802667.1.36282 WP_001802667.1.36283 WP_001802667.1.36302 WP_001802667.1.36307 WP_001802667.1.36325 WP_001802667.1.36344 WP_001802667.1.36389 WP_001802667.1.36430 WP_001802667.1.36434 WP_001802667.1.36439 WP_001802667.1.36522 WP_001802667.1.36532 WP_001802667.1.36535 WP_001802667.1.3655 WP_001802667.1.36551 WP_001802667.1.36570 WP_001802667.1.36580 WP_001802667.1.36600 WP_001802667.1.36604 WP_001802667.1.36615 WP_001802667.1.36640 WP_001802667.1.36646 WP_001802667.1.3666 WP_001802667.1.36689 WP_001802667.1.36697 WP_001802667.1.36698 WP_001802667.1.36704 WP_001802667.1.36729 WP_001802667.1.36745 WP_001802667.1.3675 WP_001802667.1.36754 WP_001802667.1.36770 WP_001802667.1.36773 WP_001802667.1.36783 WP_001802667.1.36796 WP_001802667.1.36797 WP_001802667.1.36809 WP_001802667.1.36814 WP_001802667.1.36820 WP_001802667.1.36822 WP_001802667.1.36823 WP_001802667.1.36847 WP_001802667.1.3685 WP_001802667.1.36858 WP_001802667.1.3687 WP_001802667.1.36884 WP_001802667.1.36888 WP_001802667.1.36903 WP_001802667.1.36911 WP_001802667.1.36916 WP_001802667.1.36932 WP_001802667.1.36952 WP_001802667.1.36955 WP_001802667.1.36962 WP_001802667.1.36979 WP_001802667.1.36980 WP_001802667.1.36983 WP_001802667.1.36997 WP_001802667.1.37002 WP_001802667.1.37016 WP_001802667.1.3703 WP_001802667.1.37044 WP_001802667.1.37045 WP_001802667.1.37053 WP_001802667.1.37055 WP_001802667.1.37075 WP_001802667.1.37080 WP_001802667.1.3709 WP_001802667.1.37091 WP_001802667.1.37120 WP_001802667.1.37121 WP_001802667.1.37130 WP_001802667.1.37132 WP_001802667.1.37134 WP_001802667.1.37135 WP_001802667.1.37145 WP_001802667.1.37159 WP_001802667.1.3719 WP_001802667.1.3722 WP_001802667.1.37220 WP_001802667.1.37240 WP_001802667.1.37304 WP_001802667.1.37335 WP_001802667.1.37336 WP_001802667.1.37341 WP_001802667.1.37343 WP_001802667.1.37354 WP_001802667.1.37378 WP_001802667.1.37398 WP_001802667.1.37408 WP_001802667.1.37411 WP_001802667.1.37424 WP_001802667.1.37435 WP_001802667.1.37453 WP_001802667.1.37467 WP_001802667.1.37503 WP_001802667.1.37525 WP_001802667.1.37536 WP_001802667.1.37546 WP_001802667.1.37563 WP_001802667.1.37578 WP_001802667.1.37583 WP_001802667.1.37602 WP_001802667.1.37605 WP_001802667.1.37606 WP_001802667.1.37621 WP_001802667.1.37624 WP_001802667.1.37636 WP_001802667.1.37644 WP_001802667.1.37652 WP_001802667.1.37669 WP_001802667.1.37679 WP_001802667.1.3774 WP_001802667.1.37749 WP_001802667.1.3776 WP_001802667.1.37764 WP_001802667.1.37771 WP_001802667.1.37781 WP_001802667.1.37788 WP_001802667.1.37795 WP_001802667.1.37828 WP_001802667.1.3784 WP_001802667.1.37851 WP_001802667.1.37855 WP_001802667.1.37866 WP_001802667.1.37875 WP_001802667.1.37878 WP_001802667.1.37891 WP_001802667.1.37906 WP_001802667.1.37907 WP_001802667.1.37929 WP_001802667.1.37987 WP_001802667.1.38007 WP_001802667.1.38020 WP_001802667.1.38030 WP_001802667.1.38034 WP_001802667.1.38038 WP_001802667.1.38070 WP_001802667.1.38082 WP_001802667.1.3809 WP_001802667.1.38100 WP_001802667.1.38111 WP_001802667.1.38128 WP_001802667.1.3813 WP_001802667.1.38136 WP_001802667.1.38148 WP_001802667.1.38160 WP_001802667.1.3817 WP_001802667.1.38177 WP_001802667.1.3820 WP_001802667.1.38212 WP_001802667.1.38222 WP_001802667.1.38229 WP_001802667.1.38230 WP_001802667.1.38232 WP_001802667.1.3827 WP_001802667.1.38276 WP_001802667.1.38282 WP_001802667.1.38304 WP_001802667.1.38309 WP_001802667.1.38311 WP_001802667.1.38316 WP_001802667.1.38330 WP_001802667.1.38336 WP_001802667.1.38339 WP_001802667.1.38346 WP_001802667.1.38383 WP_001802667.1.38390 WP_001802667.1.3842 WP_001802667.1.38422 WP_001802667.1.38435 WP_001802667.1.38437 WP_001802667.1.38453 WP_001802667.1.38489 WP_001802667.1.38491 WP_001802667.1.38493 WP_001802667.1.3850 WP_001802667.1.38516 WP_001802667.1.38522 WP_001802667.1.38546 WP_001802667.1.38551 WP_001802667.1.38555 WP_001802667.1.38557 WP_001802667.1.38600 WP_001802667.1.38607 WP_001802667.1.38612 WP_001802667.1.38637 WP_001802667.1.38651 WP_001802667.1.38658 WP_001802667.1.3867 WP_001802667.1.38674 WP_001802667.1.38688 WP_001802667.1.38721 WP_001802667.1.3875 WP_001802667.1.38760 WP_001802667.1.38786 WP_001802667.1.38788 WP_001802667.1.38823 WP_001802667.1.38836 WP_001802667.1.38841 WP_001802667.1.38858 WP_001802667.1.38862 WP_001802667.1.38875 WP_001802667.1.38885 WP_001802667.1.38890 WP_001802667.1.38926 WP_001802667.1.38927 WP_001802667.1.38931 WP_001802667.1.3894 WP_001802667.1.38940 WP_001802667.1.38941 WP_001802667.1.38943 WP_001802667.1.38960 WP_001802667.1.38972 WP_001802667.1.38979 WP_001802667.1.38985 WP_001802667.1.38989 WP_001802667.1.390 WP_001802667.1.39012 WP_001802667.1.39014 WP_001802667.1.39017 WP_001802667.1.39020 WP_001802667.1.39026 WP_001802667.1.39043 WP_001802667.1.39053 WP_001802667.1.3906 WP_001802667.1.3908 WP_001802667.1.39080 WP_001802667.1.39089 WP_001802667.1.391 WP_001802667.1.39108 WP_001802667.1.39117 WP_001802667.1.39126 WP_001802667.1.39166 WP_001802667.1.39173 WP_001802667.1.39203 WP_001802667.1.39206 WP_001802667.1.39217 WP_001802667.1.3926 WP_001802667.1.39272 WP_001802667.1.39281 WP_001802667.1.39285 WP_001802667.1.39290 WP_001802667.1.39324 WP_001802667.1.39330 WP_001802667.1.39332 WP_001802667.1.39333 WP_001802667.1.39347 WP_001802667.1.39361 WP_001802667.1.39384 WP_001802667.1.39397 WP_001802667.1.39406 WP_001802667.1.39432 WP_001802667.1.39451 WP_001802667.1.39486 WP_001802667.1.39494 WP_001802667.1.39499 WP_001802667.1.39506 WP_001802667.1.39519 WP_001802667.1.39527 WP_001802667.1.39542 WP_001802667.1.39550 WP_001802667.1.39613 WP_001802667.1.39625 WP_001802667.1.39642 WP_001802667.1.39645 WP_001802667.1.39662 WP_001802667.1.39670 WP_001802667.1.39671 WP_001802667.1.39682 WP_001802667.1.39687 WP_001802667.1.39689 WP_001802667.1.39693 WP_001802667.1.39697 WP_001802667.1.39711 WP_001802667.1.39767 WP_001802667.1.39773 WP_001802667.1.39789 WP_001802667.1.39812 WP_001802667.1.39832 WP_001802667.1.39834 WP_001802667.1.39838 WP_001802667.1.39847 WP_001802667.1.39856 WP_001802667.1.39857 WP_001802667.1.39869 WP_001802667.1.39875 WP_001802667.1.39880 WP_001802667.1.39883 WP_001802667.1.39943 WP_001802667.1.39995 WP_001802667.1.40014 WP_001802667.1.40043 WP_001802667.1.40053 WP_001802667.1.4006 WP_001802667.1.40076 WP_001802667.1.40082 WP_001802667.1.40085 WP_001802667.1.40099 WP_001802667.1.4010 WP_001802667.1.40119 WP_001802667.1.4012 WP_001802667.1.40120 WP_001802667.1.40130 WP_001802667.1.40149 WP_001802667.1.4015 WP_001802667.1.40164 WP_001802667.1.40173 WP_001802667.1.4019 WP_001802667.1.40220 WP_001802667.1.40247 WP_001802667.1.4025 WP_001802667.1.40299 WP_001802667.1.40316 WP_001802667.1.40318 WP_001802667.1.40320 WP_001802667.1.40322 WP_001802667.1.40329 WP_001802667.1.40330 WP_001802667.1.40340 WP_001802667.1.40342 WP_001802667.1.40368 WP_001802667.1.40369 WP_001802667.1.40383 WP_001802667.1.40401 WP_001802667.1.40406 WP_001802667.1.40409 WP_001802667.1.40428 WP_001802667.1.40435 WP_001802667.1.40443 WP_001802667.1.4045 WP_001802667.1.40454 WP_001802667.1.40458 WP_001802667.1.40463 WP_001802667.1.40472 WP_001802667.1.40474 WP_001802667.1.40481 WP_001802667.1.40483 WP_001802667.1.40500 WP_001802667.1.40505 WP_001802667.1.40531 WP_001802667.1.40532 WP_001802667.1.40554 WP_001802667.1.4056 WP_001802667.1.40579 WP_001802667.1.40588 WP_001802667.1.40620 WP_001802667.1.40644 WP_001802667.1.40655 WP_001802667.1.40658 WP_001802667.1.40700 WP_001802667.1.40719 WP_001802667.1.40729 WP_001802667.1.40748 WP_001802667.1.40760 WP_001802667.1.4078 WP_001802667.1.40780 WP_001802667.1.40794 WP_001802667.1.40797 WP_001802667.1.40800 WP_001802667.1.40814 WP_001802667.1.40816 WP_001802667.1.40939 WP_001802667.1.40954 WP_001802667.1.40997 WP_001802667.1.41002 WP_001802667.1.41011 WP_001802667.1.4102 WP_001802667.1.41033 WP_001802667.1.41038 WP_001802667.1.4105 WP_001802667.1.41058 WP_001802667.1.41064 WP_001802667.1.41066 WP_001802667.1.41084 WP_001802667.1.41094 WP_001802667.1.41098 WP_001802667.1.41104 WP_001802667.1.41109 WP_001802667.1.41119 WP_001802667.1.41122 WP_001802667.1.41129 WP_001802667.1.41133 WP_001802667.1.4115 WP_001802667.1.41178 WP_001802667.1.412 WP_001802667.1.41208 WP_001802667.1.41238 WP_001802667.1.41241 WP_001802667.1.41245 WP_001802667.1.41255 WP_001802667.1.41288 WP_001802667.1.41289 WP_001802667.1.4129 WP_001802667.1.41314 WP_001802667.1.41341 WP_001802667.1.41350 WP_001802667.1.41374 WP_001802667.1.4138 WP_001802667.1.41386 WP_001802667.1.41389 WP_001802667.1.41411 WP_001802667.1.41426 WP_001802667.1.41432 WP_001802667.1.41433 WP_001802667.1.4144 WP_001802667.1.41444 WP_001802667.1.41448 WP_001802667.1.41458 WP_001802667.1.41461 WP_001802667.1.41473 WP_001802667.1.41499 WP_001802667.1.41511 WP_001802667.1.41532 WP_001802667.1.41533 WP_001802667.1.41537 WP_001802667.1.41555 WP_001802667.1.41558 WP_001802667.1.41567 WP_001802667.1.41581 WP_001802667.1.41582 WP_001802667.1.41587 WP_001802667.1.41597 WP_001802667.1.41598 WP_001802667.1.41599 WP_001802667.1.4160 WP_001802667.1.41612 WP_001802667.1.4162 WP_001802667.1.41620 WP_001802667.1.41623 WP_001802667.1.41647 WP_001802667.1.41674 WP_001802667.1.41681 WP_001802667.1.4169 WP_001802667.1.41698 WP_001802667.1.41726 WP_001802667.1.41743 WP_001802667.1.41755 WP_001802667.1.41770 WP_001802667.1.41796 WP_001802667.1.41817 WP_001802667.1.4182 WP_001802667.1.41821 WP_001802667.1.41839 WP_001802667.1.41863 WP_001802667.1.4188 WP_001802667.1.41891 WP_001802667.1.41898 WP_001802667.1.41906 WP_001802667.1.41935 WP_001802667.1.41943 WP_001802667.1.41954 WP_001802667.1.41972 WP_001802667.1.41983 WP_001802667.1.41989 WP_001802667.1.420 WP_001802667.1.42001 WP_001802667.1.42003 WP_001802667.1.42005 WP_001802667.1.42015 WP_001802667.1.42017 WP_001802667.1.4202 WP_001802667.1.42028 WP_001802667.1.42064 WP_001802667.1.42072 WP_001802667.1.42085 WP_001802667.1.42087 WP_001802667.1.42125 WP_001802667.1.42137 WP_001802667.1.42169 WP_001802667.1.42177 WP_001802667.1.42178 WP_001802667.1.42198 WP_001802667.1.42230 WP_001802667.1.42241 WP_001802667.1.4225 WP_001802667.1.42269 WP_001802667.1.42286 WP_001802667.1.42298 WP_001802667.1.42305 WP_001802667.1.4231 WP_001802667.1.42325 WP_001802667.1.42336 WP_001802667.1.42344 WP_001802667.1.42355 WP_001802667.1.42403 WP_001802667.1.42436 WP_001802667.1.42438 WP_001802667.1.42455 WP_001802667.1.42459 WP_001802667.1.42460 WP_001802667.1.42481 WP_001802667.1.42503 WP_001802667.1.42510 WP_001802667.1.42517 WP_001802667.1.42551 WP_001802667.1.42593 WP_001802667.1.42598 WP_001802667.1.426 WP_001802667.1.4260 WP_001802667.1.42607 WP_001802667.1.42640 WP_001802667.1.42652 WP_001802667.1.42667 WP_001802667.1.42668 WP_001802667.1.42674 WP_001802667.1.42679 WP_001802667.1.42681 WP_001802667.1.42706 WP_001802667.1.42733 WP_001802667.1.42737 WP_001802667.1.42738 WP_001802667.1.42740 WP_001802667.1.42759 WP_001802667.1.42786 WP_001802667.1.42788 WP_001802667.1.42798 WP_001802667.1.42802 WP_001802667.1.42816 WP_001802667.1.42819 WP_001802667.1.42837 WP_001802667.1.42848 WP_001802667.1.42883 WP_001802667.1.42893 WP_001802667.1.42897 WP_001802667.1.42907 WP_001802667.1.42924 WP_001802667.1.42925 WP_001802667.1.4293 WP_001802667.1.42959 WP_001802667.1.42982 WP_001802667.1.42984 WP_001802667.1.42985 WP_001802667.1.4299 WP_001802667.1.42990 WP_001802667.1.4300 WP_001802667.1.43014 WP_001802667.1.43020 WP_001802667.1.43023 WP_001802667.1.43033 WP_001802667.1.43047 WP_001802667.1.43061 WP_001802667.1.43072 WP_001802667.1.43095 WP_001802667.1.43110 WP_001802667.1.43114 WP_001802667.1.43122 WP_001802667.1.43125 WP_001802667.1.43131 WP_001802667.1.43134 WP_001802667.1.43139 WP_001802667.1.43143 WP_001802667.1.43147 WP_001802667.1.43159 WP_001802667.1.43165 WP_001802667.1.43168 WP_001802667.1.43179 WP_001802667.1.43200 WP_001802667.1.43202 WP_001802667.1.43204 WP_001802667.1.43206 WP_001802667.1.43220 WP_001802667.1.43225 WP_001802667.1.43232 WP_001802667.1.43248 WP_001802667.1.4325 WP_001802667.1.43252 WP_001802667.1.43263 WP_001802667.1.4327 WP_001802667.1.43274 WP_001802667.1.43279 WP_001802667.1.43323 WP_001802667.1.43325 WP_001802667.1.43328 WP_001802667.1.43331 WP_001802667.1.43341 WP_001802667.1.43349 WP_001802667.1.43360 WP_001802667.1.43366 WP_001802667.1.43369 WP_001802667.1.4337 WP_001802667.1.43375 WP_001802667.1.43405 WP_001802667.1.43406 WP_001802667.1.4341 WP_001802667.1.43410 WP_001802667.1.43446 WP_001802667.1.43460 WP_001802667.1.4347 WP_001802667.1.43506 WP_001802667.1.43512 WP_001802667.1.43530 WP_001802667.1.43550 WP_001802667.1.43560 WP_001802667.1.43573 WP_001802667.1.43594 WP_001802667.1.43600 WP_001802667.1.43617 WP_001802667.1.43618 WP_001802667.1.43627 WP_001802667.1.43659 WP_001802667.1.43665 WP_001802667.1.43670 WP_001802667.1.43683 WP_001802667.1.43693 WP_001802667.1.4370 WP_001802667.1.43702 WP_001802667.1.43703 WP_001802667.1.4372 WP_001802667.1.43731 WP_001802667.1.4374 WP_001802667.1.43752 WP_001802667.1.43784 WP_001802667.1.43788 WP_001802667.1.4379 WP_001802667.1.4380 WP_001802667.1.43800 WP_001802667.1.43819 WP_001802667.1.43822 WP_001802667.1.43827 WP_001802667.1.4385 WP_001802667.1.43851 WP_001802667.1.4386 WP_001802667.1.43904 WP_001802667.1.43915 WP_001802667.1.43924 WP_001802667.1.43984 WP_001802667.1.43988 WP_001802667.1.43995 WP_001802667.1.44021 WP_001802667.1.44072 WP_001802667.1.44074 WP_001802667.1.44095 WP_001802667.1.44119 WP_001802667.1.44150 WP_001802667.1.44153 WP_001802667.1.44177 WP_001802667.1.44178 WP_001802667.1.44181 WP_001802667.1.44186 WP_001802667.1.44195 WP_001802667.1.44255 WP_001802667.1.44265 WP_001802667.1.44302 WP_001802667.1.44312 WP_001802667.1.44331 WP_001802667.1.44344 WP_001802667.1.44382 WP_001802667.1.44388 WP_001802667.1.44396 WP_001802667.1.44405 WP_001802667.1.44420 WP_001802667.1.44432 WP_001802667.1.44455 WP_001802667.1.44480 WP_001802667.1.44504 WP_001802667.1.44515 WP_001802667.1.44517 WP_001802667.1.44520 WP_001802667.1.44536 WP_001802667.1.44547 WP_001802667.1.44579 WP_001802667.1.44586 WP_001802667.1.44588 WP_001802667.1.44605 WP_001802667.1.44623 WP_001802667.1.44631 WP_001802667.1.44646 WP_001802667.1.44655 WP_001802667.1.44667 WP_001802667.1.44672 WP_001802667.1.44674 WP_001802667.1.447 WP_001802667.1.44714 WP_001802667.1.44715 WP_001802667.1.44732 WP_001802667.1.44755 WP_001802667.1.44768 WP_001802667.1.44785 WP_001802667.1.44788 WP_001802667.1.44796 WP_001802667.1.44802 WP_001802667.1.44853 WP_001802667.1.44856 WP_001802667.1.44868 WP_001802667.1.44881 WP_001802667.1.44882 WP_001802667.1.44891 WP_001802667.1.44892 WP_001802667.1.44899 WP_001802667.1.44903 WP_001802667.1.44914 WP_001802667.1.44932 WP_001802667.1.44940 WP_001802667.1.44948 WP_001802667.1.44955 WP_001802667.1.44969 WP_001802667.1.4499 WP_001802667.1.44993 WP_001802667.1.45008 WP_001802667.1.45010 WP_001802667.1.45015 WP_001802667.1.45033 WP_001802667.1.45035 WP_001802667.1.45042 WP_001802667.1.45050 WP_001802667.1.45080 WP_001802667.1.45091 WP_001802667.1.45094 WP_001802667.1.45099 WP_001802667.1.45101 WP_001802667.1.45111 WP_001802667.1.45114 WP_001802667.1.4513 WP_001802667.1.45131 WP_001802667.1.45132 WP_001802667.1.45133 WP_001802667.1.45140 WP_001802667.1.45157 WP_001802667.1.45162 WP_001802667.1.45164 WP_001802667.1.45170 WP_001802667.1.45188 WP_001802667.1.45189 WP_001802667.1.452 WP_001802667.1.45218 WP_001802667.1.45221 WP_001802667.1.45223 WP_001802667.1.45242 WP_001802667.1.45267 WP_001802667.1.4527 WP_001802667.1.45272 WP_001802667.1.45281 WP_001802667.1.45290 WP_001802667.1.45297 WP_001802667.1.45303 WP_001802667.1.45321 WP_001802667.1.45332 WP_001802667.1.45364 WP_001802667.1.45419 WP_001802667.1.45431 WP_001802667.1.45439 WP_001802667.1.4545 WP_001802667.1.45450 WP_001802667.1.45456 WP_001802667.1.4546 WP_001802667.1.45472 WP_001802667.1.45492 WP_001802667.1.4550 WP_001802667.1.45507 WP_001802667.1.45542 WP_001802667.1.45555 WP_001802667.1.45560 WP_001802667.1.45574 WP_001802667.1.45577 WP_001802667.1.45586 WP_001802667.1.45610 WP_001802667.1.45620 WP_001802667.1.45640 WP_001802667.1.45645 WP_001802667.1.45654 WP_001802667.1.45698 WP_001802667.1.45703 WP_001802667.1.45705 WP_001802667.1.45713 WP_001802667.1.45730 WP_001802667.1.45734 WP_001802667.1.45747 WP_001802667.1.45763 WP_001802667.1.45768 WP_001802667.1.4577 WP_001802667.1.45771 WP_001802667.1.45773 WP_001802667.1.45780 WP_001802667.1.4580 WP_001802667.1.45822 WP_001802667.1.45833 WP_001802667.1.4584 WP_001802667.1.45852 WP_001802667.1.45859 WP_001802667.1.45862 WP_001802667.1.45870 WP_001802667.1.45874 WP_001802667.1.45875 WP_001802667.1.45878 WP_001802667.1.45881 WP_001802667.1.45888 WP_001802667.1.45897 WP_001802667.1.459 WP_001802667.1.45954 WP_001802667.1.4597 WP_001802667.1.45972 WP_001802667.1.45977 WP_001802667.1.45979 WP_001802667.1.4598 WP_001802667.1.46003 WP_001802667.1.46005 WP_001802667.1.46013 WP_001802667.1.46021 WP_001802667.1.46035 WP_001802667.1.46037 WP_001802667.1.46050 WP_001802667.1.46055 WP_001802667.1.46062 WP_001802667.1.46071 WP_001802667.1.46078 WP_001802667.1.46082 WP_001802667.1.46087 WP_001802667.1.46106 WP_001802667.1.46109 WP_001802667.1.46136 WP_001802667.1.46168 WP_001802667.1.46171 WP_001802667.1.46172 WP_001802667.1.46195 WP_001802667.1.46212 WP_001802667.1.46222 WP_001802667.1.46228 WP_001802667.1.46248 WP_001802667.1.46259 WP_001802667.1.46276 WP_001802667.1.46289 WP_001802667.1.46320 WP_001802667.1.46330 WP_001802667.1.46333 WP_001802667.1.46334 WP_001802667.1.46339 WP_001802667.1.46353 WP_001802667.1.46362 WP_001802667.1.46368 WP_001802667.1.46380 WP_001802667.1.46389 WP_001802667.1.46401 WP_001802667.1.46418 WP_001802667.1.46422 WP_001802667.1.46457 WP_001802667.1.46465 WP_001802667.1.46488 WP_001802667.1.46514 WP_001802667.1.46528 WP_001802667.1.46529 WP_001802667.1.46534 WP_001802667.1.46543 WP_001802667.1.46576 WP_001802667.1.46587 WP_001802667.1.46608 WP_001802667.1.46619 WP_001802667.1.4662 WP_001802667.1.46648 WP_001802667.1.46660 WP_001802667.1.46664 WP_001802667.1.46670 WP_001802667.1.46676 WP_001802667.1.46688 WP_001802667.1.46692 WP_001802667.1.46696 WP_001802667.1.46702 WP_001802667.1.46703 WP_001802667.1.46720 WP_001802667.1.46736 WP_001802667.1.46752 WP_001802667.1.46765 WP_001802667.1.46767 WP_001802667.1.46770 WP_001802667.1.46772 WP_001802667.1.4680 WP_001802667.1.46815 WP_001802667.1.46823 WP_001802667.1.46852 WP_001802667.1.46875 WP_001802667.1.46881 WP_001802667.1.46906 WP_001802667.1.46908 WP_001802667.1.46914 WP_001802667.1.46925 WP_001802667.1.46929 WP_001802667.1.46937 WP_001802667.1.4694 WP_001802667.1.46947 WP_001802667.1.4696 WP_001802667.1.46964 WP_001802667.1.46965 WP_001802667.1.46983 WP_001802667.1.46995 WP_001802667.1.47002 WP_001802667.1.47051 WP_001802667.1.47065 WP_001802667.1.47090 WP_001802667.1.47105 WP_001802667.1.47107 WP_001802667.1.47111 WP_001802667.1.47128 WP_001802667.1.47153 WP_001802667.1.47159 WP_001802667.1.4716 WP_001802667.1.47163 WP_001802667.1.47187 WP_001802667.1.47193 WP_001802667.1.47205 WP_001802667.1.47211 WP_001802667.1.47216 WP_001802667.1.47218 WP_001802667.1.47250 WP_001802667.1.47258 WP_001802667.1.47269 WP_001802667.1.47276 WP_001802667.1.47279 WP_001802667.1.4728 WP_001802667.1.47282 WP_001802667.1.47290 WP_001802667.1.47294 WP_001802667.1.47306 WP_001802667.1.47308 WP_001802667.1.47317 WP_001802667.1.47328 WP_001802667.1.47331 WP_001802667.1.47334 WP_001802667.1.47353 WP_001802667.1.47381 WP_001802667.1.47383 WP_001802667.1.47399 WP_001802667.1.47405 WP_001802667.1.47406 WP_001802667.1.47408 WP_001802667.1.47422 WP_001802667.1.47426 WP_001802667.1.47432 WP_001802667.1.47439 WP_001802667.1.47450 WP_001802667.1.47459 WP_001802667.1.47493 WP_001802667.1.4752 WP_001802667.1.47522 WP_001802667.1.47530 WP_001802667.1.47541 WP_001802667.1.47554 WP_001802667.1.47560 WP_001802667.1.47561 WP_001802667.1.47570 WP_001802667.1.47577 WP_001802667.1.47617 WP_001802667.1.47618 WP_001802667.1.47629 WP_001802667.1.47667 WP_001802667.1.47669 WP_001802667.1.4767 WP_001802667.1.47680 WP_001802667.1.477 WP_001802667.1.47702 WP_001802667.1.47719 WP_001802667.1.47733 WP_001802667.1.47747 WP_001802667.1.47763 WP_001802667.1.47782 WP_001802667.1.47792 WP_001802667.1.47821 WP_001802667.1.47835 WP_001802667.1.47836 WP_001802667.1.47859 WP_001802667.1.47864 WP_001802667.1.47872 WP_001802667.1.47873 WP_001802667.1.47888 WP_001802667.1.47901 WP_001802667.1.47904 WP_001802667.1.47908 WP_001802667.1.4792 WP_001802667.1.47951 WP_001802667.1.47980 WP_001802667.1.47989 WP_001802667.1.47996 WP_001802667.1.48009 WP_001802667.1.48011 WP_001802667.1.48013 WP_001802667.1.48017 WP_001802667.1.48030 WP_001802667.1.48046 WP_001802667.1.48047 WP_001802667.1.4805 WP_001802667.1.48057 WP_001802667.1.48064 WP_001802667.1.48067 WP_001802667.1.48116 WP_001802667.1.48142 WP_001802667.1.48149 WP_001802667.1.4815 WP_001802667.1.48154 WP_001802667.1.48156 WP_001802667.1.48169 WP_001802667.1.48187 WP_001802667.1.48197 WP_001802667.1.48199 WP_001802667.1.48212 WP_001802667.1.48223 WP_001802667.1.48227 WP_001802667.1.48236 WP_001802667.1.48250 WP_001802667.1.48272 WP_001802667.1.48282 WP_001802667.1.48284 WP_001802667.1.48293 WP_001802667.1.48307 WP_001802667.1.48310 WP_001802667.1.48322 WP_001802667.1.48326 WP_001802667.1.48335 WP_001802667.1.48338 WP_001802667.1.48364 WP_001802667.1.48376 WP_001802667.1.48391 WP_001802667.1.48394 WP_001802667.1.48398 WP_001802667.1.484 WP_001802667.1.4840 WP_001802667.1.48425 WP_001802667.1.48427 WP_001802667.1.48437 WP_001802667.1.48438 WP_001802667.1.48463 WP_001802667.1.48492 WP_001802667.1.4852 WP_001802667.1.48556 WP_001802667.1.48563 WP_001802667.1.48577 WP_001802667.1.48580 WP_001802667.1.48593 WP_001802667.1.48601 WP_001802667.1.48634 WP_001802667.1.48655 WP_001802667.1.48656 WP_001802667.1.48670 WP_001802667.1.4868 WP_001802667.1.48694 WP_001802667.1.48705 WP_001802667.1.48711 WP_001802667.1.48723 WP_001802667.1.48769 WP_001802667.1.48775 WP_001802667.1.48782 WP_001802667.1.48786 WP_001802667.1.48805 WP_001802667.1.48817 WP_001802667.1.48818 WP_001802667.1.48823 WP_001802667.1.48833 WP_001802667.1.48835 WP_001802667.1.4886 WP_001802667.1.48869 WP_001802667.1.48936 WP_001802667.1.48941 WP_001802667.1.48943 WP_001802667.1.48945 WP_001802667.1.48951 WP_001802667.1.48968 WP_001802667.1.48982 WP_001802667.1.48993 WP_001802667.1.48996 WP_001802667.1.4901 WP_001802667.1.49032 WP_001802667.1.4905 WP_001802667.1.49071 WP_001802667.1.49094 WP_001802667.1.49105 WP_001802667.1.49128 WP_001802667.1.49129 WP_001802667.1.49143 WP_001802667.1.49150 WP_001802667.1.49152 WP_001802667.1.49154 WP_001802667.1.49159 WP_001802667.1.49161 WP_001802667.1.4917 WP_001802667.1.49171 WP_001802667.1.49173 WP_001802667.1.4918 WP_001802667.1.49189 WP_001802667.1.49196 WP_001802667.1.4920 WP_001802667.1.49207 WP_001802667.1.4921 WP_001802667.1.49227 WP_001802667.1.49234 WP_001802667.1.4924 WP_001802667.1.49248 WP_001802667.1.49257 WP_001802667.1.49301 WP_001802667.1.49326 WP_001802667.1.49327 WP_001802667.1.49330 WP_001802667.1.49362 WP_001802667.1.49373 WP_001802667.1.49398 WP_001802667.1.49418 WP_001802667.1.49444 WP_001802667.1.4945 WP_001802667.1.49479 WP_001802667.1.49484 WP_001802667.1.4950 WP_001802667.1.49518 WP_001802667.1.49539 WP_001802667.1.49549 WP_001802667.1.49573 WP_001802667.1.49581 WP_001802667.1.49582 WP_001802667.1.496 WP_001802667.1.49603 WP_001802667.1.49605 WP_001802667.1.4962 WP_001802667.1.49643 WP_001802667.1.49653 WP_001802667.1.49658 WP_001802667.1.49669 WP_001802667.1.49671 WP_001802667.1.49672 WP_001802667.1.49690 WP_001802667.1.49704 WP_001802667.1.49707 WP_001802667.1.49715 WP_001802667.1.49728 WP_001802667.1.49730 WP_001802667.1.49732 WP_001802667.1.49742 WP_001802667.1.49745 WP_001802667.1.49757 WP_001802667.1.4980 WP_001802667.1.49800 WP_001802667.1.49819 WP_001802667.1.4982 WP_001802667.1.49825 WP_001802667.1.4984 WP_001802667.1.49860 WP_001802667.1.49863 WP_001802667.1.4987 WP_001802667.1.49871 WP_001802667.1.4989 WP_001802667.1.49894 WP_001802667.1.49907 WP_001802667.1.49912 WP_001802667.1.49913 WP_001802667.1.49917 WP_001802667.1.49918 WP_001802667.1.49921 WP_001802667.1.49934 WP_001802667.1.49935 WP_001802667.1.49936 WP_001802667.1.4994 WP_001802667.1.49943 WP_001802667.1.49951 WP_001802667.1.49970 WP_001802667.1.49982 WP_001802667.1.50013 WP_001802667.1.50015 WP_001802667.1.50023 WP_001802667.1.50028 WP_001802667.1.50038 WP_001802667.1.50039 WP_001802667.1.50061 WP_001802667.1.50064 WP_001802667.1.50076 WP_001802667.1.50117 WP_001802667.1.5013 WP_001802667.1.50138 WP_001802667.1.50145 WP_001802667.1.50175 WP_001802667.1.50178 WP_001802667.1.50192 WP_001802667.1.50217 WP_001802667.1.50219 WP_001802667.1.50229 WP_001802667.1.50261 WP_001802667.1.50291 WP_001802667.1.50313 WP_001802667.1.50314 WP_001802667.1.5035 WP_001802667.1.50356 WP_001802667.1.50360 WP_001802667.1.50367 WP_001802667.1.50369 WP_001802667.1.50377 WP_001802667.1.50388 WP_001802667.1.50424 WP_001802667.1.50425 WP_001802667.1.50430 WP_001802667.1.50431 WP_001802667.1.50440 WP_001802667.1.50464 WP_001802667.1.50477 WP_001802667.1.50516 WP_001802667.1.50525 WP_001802667.1.50527 WP_001802667.1.50536 WP_001802667.1.50543 WP_001802667.1.50555 WP_001802667.1.50556 WP_001802667.1.50558 WP_001802667.1.50568 WP_001802667.1.50578 WP_001802667.1.5059 WP_001802667.1.50594 WP_001802667.1.50595 WP_001802667.1.50647 WP_001802667.1.50660 WP_001802667.1.50669 WP_001802667.1.50699 WP_001802667.1.50711 WP_001802667.1.50732 WP_001802667.1.50740 WP_001802667.1.50742 WP_001802667.1.50745 WP_001802667.1.50748 WP_001802667.1.50759 WP_001802667.1.50768 WP_001802667.1.50799 WP_001802667.1.5080 WP_001802667.1.50817 WP_001802667.1.50820 WP_001802667.1.50827 WP_001802667.1.50829 WP_001802667.1.5087 WP_001802667.1.50884 WP_001802667.1.50896 WP_001802667.1.50937 WP_001802667.1.50958 WP_001802667.1.50962 WP_001802667.1.50974 WP_001802667.1.51008 WP_001802667.1.51015 WP_001802667.1.51031 WP_001802667.1.51062 WP_001802667.1.5108 WP_001802667.1.51085 WP_001802667.1.5109 WP_001802667.1.5110 WP_001802667.1.5111 WP_001802667.1.51130 WP_001802667.1.51138 WP_001802667.1.51152 WP_001802667.1.5117 WP_001802667.1.51194 WP_001802667.1.51209 WP_001802667.1.51220 WP_001802667.1.51226 WP_001802667.1.51236 WP_001802667.1.51245 WP_001802667.1.51250 WP_001802667.1.51271 WP_001802667.1.51277 WP_001802667.1.51282 WP_001802667.1.51295 WP_001802667.1.51306 WP_001802667.1.51310 WP_001802667.1.51326 WP_001802667.1.51346 WP_001802667.1.51365 WP_001802667.1.51376 WP_001802667.1.51377 WP_001802667.1.51393 WP_001802667.1.51403 WP_001802667.1.51418 WP_001802667.1.5145 WP_001802667.1.51454 WP_001802667.1.51456 WP_001802667.1.51465 WP_001802667.1.51469 WP_001802667.1.51492 WP_001802667.1.51496 WP_001802667.1.515 WP_001802667.1.51527 WP_001802667.1.5155 WP_001802667.1.51557 WP_001802667.1.51558 WP_001802667.1.51559 WP_001802667.1.51571 WP_001802667.1.51575 WP_001802667.1.51590 WP_001802667.1.51619 WP_001802667.1.51623 WP_001802667.1.51657 WP_001802667.1.51665 WP_001802667.1.51672 WP_001802667.1.51702 WP_001802667.1.51713 WP_001802667.1.51716 WP_001802667.1.51741 WP_001802667.1.51744 WP_001802667.1.51748 WP_001802667.1.51751 WP_001802667.1.51787 WP_001802667.1.51794 WP_001802667.1.51797 WP_001802667.1.51812 WP_001802667.1.51824 WP_001802667.1.51836 WP_001802667.1.51842 WP_001802667.1.51844 WP_001802667.1.5186 WP_001802667.1.51866 WP_001802667.1.51871 WP_001802667.1.51883 WP_001802667.1.5190 WP_001802667.1.51912 WP_001802667.1.51920 WP_001802667.1.51924 WP_001802667.1.51936 WP_001802667.1.51952 WP_001802667.1.51971 WP_001802667.1.51973 WP_001802667.1.51995 WP_001802667.1.52034 WP_001802667.1.52061 WP_001802667.1.52072 WP_001802667.1.52078 WP_001802667.1.5209 WP_001802667.1.521 WP_001802667.1.5213 WP_001802667.1.52151 WP_001802667.1.52162 WP_001802667.1.52182 WP_001802667.1.52185 WP_001802667.1.52193 WP_001802667.1.52195 WP_001802667.1.52198 WP_001802667.1.52210 WP_001802667.1.52251 WP_001802667.1.52252 WP_001802667.1.5228 WP_001802667.1.52289 WP_001802667.1.52296 WP_001802667.1.523 WP_001802667.1.52308 WP_001802667.1.5231 WP_001802667.1.52322 WP_001802667.1.52327 WP_001802667.1.52331 WP_001802667.1.52340 WP_001802667.1.52343 WP_001802667.1.52377 WP_001802667.1.52396 WP_001802667.1.52423 WP_001802667.1.52427 WP_001802667.1.52436 WP_001802667.1.52440 WP_001802667.1.52442 WP_001802667.1.52452 WP_001802667.1.52463 WP_001802667.1.52464 WP_001802667.1.52474 WP_001802667.1.5251 WP_001802667.1.52511 WP_001802667.1.52518 WP_001802667.1.52536 WP_001802667.1.52548 WP_001802667.1.52595 WP_001802667.1.52602 WP_001802667.1.52605 WP_001802667.1.52622 WP_001802667.1.52623 WP_001802667.1.52624 WP_001802667.1.52633 WP_001802667.1.52645 WP_001802667.1.52660 WP_001802667.1.52670 WP_001802667.1.52687 WP_001802667.1.52699 WP_001802667.1.52715 WP_001802667.1.52722 WP_001802667.1.52754 WP_001802667.1.52772 WP_001802667.1.52820 WP_001802667.1.52828 WP_001802667.1.52830 WP_001802667.1.52836 WP_001802667.1.52838 WP_001802667.1.52848 WP_001802667.1.52865 WP_001802667.1.52877 WP_001802667.1.52878 WP_001802667.1.52886 WP_001802667.1.52889 WP_001802667.1.52900 WP_001802667.1.52904 WP_001802667.1.52941 WP_001802667.1.52947 WP_001802667.1.52965 WP_001802667.1.52983 WP_001802667.1.52984 WP_001802667.1.52992 WP_001802667.1.53002 WP_001802667.1.53007 WP_001802667.1.53022 WP_001802667.1.5304 WP_001802667.1.53050 WP_001802667.1.53057 WP_001802667.1.53060 WP_001802667.1.53069 WP_001802667.1.53071 WP_001802667.1.53077 WP_001802667.1.53109 WP_001802667.1.53140 WP_001802667.1.53153 WP_001802667.1.53178 WP_001802667.1.53189 WP_001802667.1.5319 WP_001802667.1.53209 WP_001802667.1.5323 WP_001802667.1.53245 WP_001802667.1.53260 WP_001802667.1.53285 WP_001802667.1.53312 WP_001802667.1.53317 WP_001802667.1.53319 WP_001802667.1.53323 WP_001802667.1.53352 WP_001802667.1.5336 WP_001802667.1.53363 WP_001802667.1.53366 WP_001802667.1.53372 WP_001802667.1.53373 WP_001802667.1.53379 WP_001802667.1.53383 WP_001802667.1.53387 WP_001802667.1.53394 WP_001802667.1.53403 WP_001802667.1.53408 WP_001802667.1.53418 WP_001802667.1.53432 WP_001802667.1.53444 WP_001802667.1.53452 WP_001802667.1.53462 WP_001802667.1.53467 WP_001802667.1.5347 WP_001802667.1.53488 WP_001802667.1.53503 WP_001802667.1.53521 WP_001802667.1.53532 WP_001802667.1.53577 WP_001802667.1.5359 WP_001802667.1.53641 WP_001802667.1.53648 WP_001802667.1.53671 WP_001802667.1.53682 WP_001802667.1.53691 WP_001802667.1.53712 WP_001802667.1.53714 WP_001802667.1.53758 WP_001802667.1.53759 WP_001802667.1.53763 WP_001802667.1.53766 WP_001802667.1.53774 WP_001802667.1.53786 WP_001802667.1.53799 WP_001802667.1.5382 WP_001802667.1.53827 WP_001802667.1.53835 WP_001802667.1.53886 WP_001802667.1.53889 WP_001802667.1.53915 WP_001802667.1.53924 WP_001802667.1.53926 WP_001802667.1.53934 WP_001802667.1.53969 WP_001802667.1.53999 WP_001802667.1.5401 WP_001802667.1.54022 WP_001802667.1.54029 WP_001802667.1.54048 WP_001802667.1.54049 WP_001802667.1.54074 WP_001802667.1.54086 WP_001802667.1.54094 WP_001802667.1.54105 WP_001802667.1.54109 WP_001802667.1.54135 WP_001802667.1.54147 WP_001802667.1.54161 WP_001802667.1.54199 WP_001802667.1.54229 WP_001802667.1.54237 WP_001802667.1.54246 WP_001802667.1.54253 WP_001802667.1.54269 WP_001802667.1.54282 WP_001802667.1.54290 WP_001802667.1.54297 WP_001802667.1.54299 WP_001802667.1.54332 WP_001802667.1.54373 WP_001802667.1.54395 WP_001802667.1.544 WP_001802667.1.54404 WP_001802667.1.54413 WP_001802667.1.54426 WP_001802667.1.54446 WP_001802667.1.54471 WP_001802667.1.54477 WP_001802667.1.54479 WP_001802667.1.54485 WP_001802667.1.54491 WP_001802667.1.54503 WP_001802667.1.54510 WP_001802667.1.54518 WP_001802667.1.54539 WP_001802667.1.54543 WP_001802667.1.54551 WP_001802667.1.54554 WP_001802667.1.54572 WP_001802667.1.54574 WP_001802667.1.54637 WP_001802667.1.54675 WP_001802667.1.54689 WP_001802667.1.5469 WP_001802667.1.54728 WP_001802667.1.54733 WP_001802667.1.54744 WP_001802667.1.54745 WP_001802667.1.54753 WP_001802667.1.54819 WP_001802667.1.54826 WP_001802667.1.54847 WP_001802667.1.54851 WP_001802667.1.54878 WP_001802667.1.54895 WP_001802667.1.54914 WP_001802667.1.54929 WP_001802667.1.54931 WP_001802667.1.54955 WP_001802667.1.54967 WP_001802667.1.54990 WP_001802667.1.54995 WP_001802667.1.5500 WP_001802667.1.55004 WP_001802667.1.55014 WP_001802667.1.55058 WP_001802667.1.55082 WP_001802667.1.55084 WP_001802667.1.55090 WP_001802667.1.55095 WP_001802667.1.55139 WP_001802667.1.5518 WP_001802667.1.5519 WP_001802667.1.55192 WP_001802667.1.552 WP_001802667.1.55214 WP_001802667.1.55220 WP_001802667.1.55239 WP_001802667.1.55271 WP_001802667.1.55272 WP_001802667.1.55274 WP_001802667.1.55301 WP_001802667.1.55306 WP_001802667.1.55309 WP_001802667.1.55327 WP_001802667.1.55336 WP_001802667.1.55352 WP_001802667.1.55353 WP_001802667.1.5536 WP_001802667.1.55367 WP_001802667.1.55369 WP_001802667.1.55403 WP_001802667.1.55405 WP_001802667.1.55419 WP_001802667.1.55421 WP_001802667.1.55442 WP_001802667.1.55495 WP_001802667.1.5550 WP_001802667.1.55508 WP_001802667.1.55527 WP_001802667.1.55535 WP_001802667.1.55538 WP_001802667.1.5554 WP_001802667.1.55544 WP_001802667.1.55558 WP_001802667.1.5556 WP_001802667.1.55573 WP_001802667.1.55583 WP_001802667.1.5559 WP_001802667.1.55603 WP_001802667.1.5562 WP_001802667.1.55620 WP_001802667.1.55628 WP_001802667.1.55637 WP_001802667.1.5565 WP_001802667.1.55653 WP_001802667.1.55657 WP_001802667.1.557 WP_001802667.1.55717 WP_001802667.1.55719 WP_001802667.1.55724 WP_001802667.1.55728 WP_001802667.1.55746 WP_001802667.1.5575 WP_001802667.1.55784 WP_001802667.1.55786 WP_001802667.1.5580 WP_001802667.1.55818 WP_001802667.1.55831 WP_001802667.1.55835 WP_001802667.1.55839 WP_001802667.1.55845 WP_001802667.1.55848 WP_001802667.1.55854 WP_001802667.1.55859 WP_001802667.1.55867 WP_001802667.1.55874 WP_001802667.1.55886 WP_001802667.1.5589 WP_001802667.1.5590 WP_001802667.1.55904 WP_001802667.1.55916 WP_001802667.1.55933 WP_001802667.1.55949 WP_001802667.1.55953 WP_001802667.1.55955 WP_001802667.1.55960 WP_001802667.1.55985 WP_001802667.1.55991 WP_001802667.1.56000 WP_001802667.1.56003 WP_001802667.1.56025 WP_001802667.1.56039 WP_001802667.1.5604 WP_001802667.1.56048 WP_001802667.1.5606 WP_001802667.1.56064 WP_001802667.1.56078 WP_001802667.1.56098 WP_001802667.1.56099 WP_001802667.1.56106 WP_001802667.1.56135 WP_001802667.1.56153 WP_001802667.1.56159 WP_001802667.1.56200 WP_001802667.1.56210 WP_001802667.1.56213 WP_001802667.1.56214 WP_001802667.1.56225 WP_001802667.1.5623 WP_001802667.1.56237 WP_001802667.1.56239 WP_001802667.1.56241 WP_001802667.1.56260 WP_001802667.1.56265 WP_001802667.1.56272 WP_001802667.1.56275 WP_001802667.1.56281 WP_001802667.1.56306 WP_001802667.1.56332 WP_001802667.1.56333 WP_001802667.1.56343 WP_001802667.1.5635 WP_001802667.1.56364 WP_001802667.1.56387 WP_001802667.1.56400 WP_001802667.1.5644 WP_001802667.1.56453 WP_001802667.1.56464 WP_001802667.1.56482 WP_001802667.1.56496 WP_001802667.1.56522 WP_001802667.1.56525 WP_001802667.1.56527 WP_001802667.1.56530 WP_001802667.1.56542 WP_001802667.1.56558 WP_001802667.1.56570 WP_001802667.1.5658 WP_001802667.1.56584 WP_001802667.1.56598 WP_001802667.1.566 WP_001802667.1.56608 WP_001802667.1.56619 WP_001802667.1.56628 WP_001802667.1.56641 WP_001802667.1.5665 WP_001802667.1.56658 WP_001802667.1.5666 WP_001802667.1.56679 WP_001802667.1.56696 WP_001802667.1.56702 WP_001802667.1.56708 WP_001802667.1.56722 WP_001802667.1.56723 WP_001802667.1.5675 WP_001802667.1.56767 WP_001802667.1.5677 WP_001802667.1.56772 WP_001802667.1.56778 WP_001802667.1.56779 WP_001802667.1.56794 WP_001802667.1.56803 WP_001802667.1.56806 WP_001802667.1.56815 WP_001802667.1.56822 WP_001802667.1.56856 WP_001802667.1.5686 WP_001802667.1.56865 WP_001802667.1.56878 WP_001802667.1.569 WP_001802667.1.56903 WP_001802667.1.56931 WP_001802667.1.56966 WP_001802667.1.56967 WP_001802667.1.56975 WP_001802667.1.56986 WP_001802667.1.57015 WP_001802667.1.57024 WP_001802667.1.57047 WP_001802667.1.5705 WP_001802667.1.57073 WP_001802667.1.57075 WP_001802667.1.57080 WP_001802667.1.57081 WP_001802667.1.57097 WP_001802667.1.57102 WP_001802667.1.57109 WP_001802667.1.57115 WP_001802667.1.57141 WP_001802667.1.57158 WP_001802667.1.57170 WP_001802667.1.57175 WP_001802667.1.5718 WP_001802667.1.57190 WP_001802667.1.57196 WP_001802667.1.57214 WP_001802667.1.57223 WP_001802667.1.57265 WP_001802667.1.57271 WP_001802667.1.57291 WP_001802667.1.57309 WP_001802667.1.57316 WP_001802667.1.57330 WP_001802667.1.57338 WP_001802667.1.5735 WP_001802667.1.57370 WP_001802667.1.57376 WP_001802667.1.57385 WP_001802667.1.57389 WP_001802667.1.57427 WP_001802667.1.5743 WP_001802667.1.57445 WP_001802667.1.57459 WP_001802667.1.57481 WP_001802667.1.5749 WP_001802667.1.57507 WP_001802667.1.5752 WP_001802667.1.57577 WP_001802667.1.57593 WP_001802667.1.57594 WP_001802667.1.57612 WP_001802667.1.57614 WP_001802667.1.5763 WP_001802667.1.57635 WP_001802667.1.57650 WP_001802667.1.57665 WP_001802667.1.57670 WP_001802667.1.57682 WP_001802667.1.57692 WP_001802667.1.57693 WP_001802667.1.5770 WP_001802667.1.57701 WP_001802667.1.57718 WP_001802667.1.57720 WP_001802667.1.57723 WP_001802667.1.57727 WP_001802667.1.57730 WP_001802667.1.57734 WP_001802667.1.57745 WP_001802667.1.57754 WP_001802667.1.57761 WP_001802667.1.57770 WP_001802667.1.57783 WP_001802667.1.57808 WP_001802667.1.57819 WP_001802667.1.57837 WP_001802667.1.57840 WP_001802667.1.57844 WP_001802667.1.57861 WP_001802667.1.57875 WP_001802667.1.57878 WP_001802667.1.57883 WP_001802667.1.57888 WP_001802667.1.579 WP_001802667.1.5791 WP_001802667.1.57910 WP_001802667.1.57915 WP_001802667.1.57928 WP_001802667.1.57943 WP_001802667.1.57944 WP_001802667.1.57952 WP_001802667.1.57962 WP_001802667.1.57974 WP_001802667.1.5799 WP_001802667.1.58005 WP_001802667.1.58006 WP_001802667.1.58014 WP_001802667.1.58016 WP_001802667.1.58017 WP_001802667.1.58035 WP_001802667.1.58042 WP_001802667.1.58049 WP_001802667.1.58050 WP_001802667.1.58051 WP_001802667.1.58074 WP_001802667.1.58106 WP_001802667.1.58116 WP_001802667.1.58122 WP_001802667.1.58127 WP_001802667.1.58139 WP_001802667.1.58148 WP_001802667.1.58158 WP_001802667.1.5816 WP_001802667.1.5817 WP_001802667.1.58175 WP_001802667.1.58185 WP_001802667.1.58198 WP_001802667.1.58212 WP_001802667.1.58241 WP_001802667.1.58242 WP_001802667.1.58246 WP_001802667.1.5827 WP_001802667.1.58277 WP_001802667.1.58317 WP_001802667.1.5832 WP_001802667.1.58321 WP_001802667.1.58325 WP_001802667.1.58350 WP_001802667.1.58352 WP_001802667.1.58353 WP_001802667.1.58364 WP_001802667.1.58366 WP_001802667.1.58373 WP_001802667.1.58388 WP_001802667.1.58392 WP_001802667.1.58395 WP_001802667.1.58413 WP_001802667.1.58419 WP_001802667.1.58421 WP_001802667.1.58430 WP_001802667.1.58435 WP_001802667.1.58473 WP_001802667.1.58481 WP_001802667.1.5849 WP_001802667.1.58495 WP_001802667.1.58497 WP_001802667.1.58504 WP_001802667.1.58508 WP_001802667.1.58512 WP_001802667.1.58521 WP_001802667.1.58530 WP_001802667.1.58538 WP_001802667.1.58549 WP_001802667.1.5857 WP_001802667.1.58571 WP_001802667.1.58584 WP_001802667.1.58588 WP_001802667.1.58592 WP_001802667.1.58598 WP_001802667.1.586 WP_001802667.1.58603 WP_001802667.1.58686 WP_001802667.1.58701 WP_001802667.1.58704 WP_001802667.1.58714 WP_001802667.1.58718 WP_001802667.1.58735 WP_001802667.1.58760 WP_001802667.1.58763 WP_001802667.1.58772 WP_001802667.1.58775 WP_001802667.1.58798 WP_001802667.1.5880 WP_001802667.1.58833 WP_001802667.1.58839 WP_001802667.1.58855 WP_001802667.1.58860 WP_001802667.1.58934 WP_001802667.1.58936 WP_001802667.1.58981 WP_001802667.1.58991 WP_001802667.1.58998 WP_001802667.1.5901 WP_001802667.1.59011 WP_001802667.1.59014 WP_001802667.1.59039 WP_001802667.1.59046 WP_001802667.1.59062 WP_001802667.1.59077 WP_001802667.1.59098 WP_001802667.1.59124 WP_001802667.1.59133 WP_001802667.1.59135 WP_001802667.1.59146 WP_001802667.1.59157 WP_001802667.1.59175 WP_001802667.1.59178 WP_001802667.1.59187 WP_001802667.1.5920 WP_001802667.1.59203 WP_001802667.1.59213 WP_001802667.1.5925 WP_001802667.1.59269 WP_001802667.1.59284 WP_001802667.1.5930 WP_001802667.1.59311 WP_001802667.1.59327 WP_001802667.1.59329 WP_001802667.1.59334 WP_001802667.1.59337 WP_001802667.1.59363 WP_001802667.1.5938 WP_001802667.1.59380 WP_001802667.1.59397 WP_001802667.1.59398 WP_001802667.1.5940 WP_001802667.1.59401 WP_001802667.1.59404 WP_001802667.1.59414 WP_001802667.1.59441 WP_001802667.1.59457 WP_001802667.1.59459 WP_001802667.1.59462 WP_001802667.1.59464 WP_001802667.1.59467 WP_001802667.1.59478 WP_001802667.1.59489 WP_001802667.1.59498 WP_001802667.1.59540 WP_001802667.1.59546 WP_001802667.1.59547 WP_001802667.1.59567 WP_001802667.1.59594 WP_001802667.1.59598 WP_001802667.1.59603 WP_001802667.1.59609 WP_001802667.1.59624 WP_001802667.1.59629 WP_001802667.1.59643 WP_001802667.1.59663 WP_001802667.1.59668 WP_001802667.1.59669 WP_001802667.1.59671 WP_001802667.1.59697 WP_001802667.1.5972 WP_001802667.1.59787 WP_001802667.1.59803 WP_001802667.1.59810 WP_001802667.1.59819 WP_001802667.1.5982 WP_001802667.1.59822 WP_001802667.1.59864 WP_001802667.1.59874 WP_001802667.1.59881 WP_001802667.1.59886 WP_001802667.1.59896 WP_001802667.1.59907 WP_001802667.1.59915 WP_001802667.1.59921 WP_001802667.1.59977 WP_001802667.1.60001 WP_001802667.1.60006 WP_001802667.1.60022 WP_001802667.1.6006 WP_001802667.1.60086 WP_001802667.1.60101 WP_001802667.1.60107 WP_001802667.1.6011 WP_001802667.1.60118 WP_001802667.1.60123 WP_001802667.1.60124 WP_001802667.1.60147 WP_001802667.1.60149 WP_001802667.1.60156 WP_001802667.1.60157 WP_001802667.1.60165 WP_001802667.1.6017 WP_001802667.1.602 WP_001802667.1.60201 WP_001802667.1.60227 WP_001802667.1.60251 WP_001802667.1.60259 WP_001802667.1.60280 WP_001802667.1.60289 WP_001802667.1.60302 WP_001802667.1.60307 WP_001802667.1.60339 WP_001802667.1.6034 WP_001802667.1.60345 WP_001802667.1.60353 WP_001802667.1.60355 WP_001802667.1.60360 WP_001802667.1.60368 WP_001802667.1.60382 WP_001802667.1.60414 WP_001802667.1.60431 WP_001802667.1.60434 WP_001802667.1.6045 WP_001802667.1.60462 WP_001802667.1.60473 WP_001802667.1.60492 WP_001802667.1.60493 WP_001802667.1.60515 WP_001802667.1.60530 WP_001802667.1.60547 WP_001802667.1.60551 WP_001802667.1.60585 WP_001802667.1.60594 WP_001802667.1.60595 WP_001802667.1.60636 WP_001802667.1.60641 WP_001802667.1.60675 WP_001802667.1.60677 WP_001802667.1.60690 WP_001802667.1.60696 WP_001802667.1.60704 WP_001802667.1.60719 WP_001802667.1.60730 WP_001802667.1.60734 WP_001802667.1.60742 WP_001802667.1.60750 WP_001802667.1.60751 WP_001802667.1.60758 WP_001802667.1.60759 WP_001802667.1.60765 WP_001802667.1.60778 WP_001802667.1.60787 WP_001802667.1.60813 WP_001802667.1.60820 WP_001802667.1.60845 WP_001802667.1.6085 WP_001802667.1.60859 WP_001802667.1.60869 WP_001802667.1.60888 WP_001802667.1.60898 WP_001802667.1.60912 WP_001802667.1.60917 WP_001802667.1.60923 WP_001802667.1.60934 WP_001802667.1.60939 WP_001802667.1.60943 WP_001802667.1.60946 WP_001802667.1.60948 WP_001802667.1.60949 WP_001802667.1.60965 WP_001802667.1.60981 WP_001802667.1.60991 WP_001802667.1.61009 WP_001802667.1.61013 WP_001802667.1.61019 WP_001802667.1.61023 WP_001802667.1.61026 WP_001802667.1.61029 WP_001802667.1.61030 WP_001802667.1.61031 WP_001802667.1.61077 WP_001802667.1.61082 WP_001802667.1.61107 WP_001802667.1.61115 WP_001802667.1.61119 WP_001802667.1.61139 WP_001802667.1.61152 WP_001802667.1.61153 WP_001802667.1.6118 WP_001802667.1.61187 WP_001802667.1.61189 WP_001802667.1.6119 WP_001802667.1.61215 WP_001802667.1.61224 WP_001802667.1.6123 WP_001802667.1.61257 WP_001802667.1.61261 WP_001802667.1.61263 WP_001802667.1.61271 WP_001802667.1.61277 WP_001802667.1.61286 WP_001802667.1.61289 WP_001802667.1.61313 WP_001802667.1.61316 WP_001802667.1.61318 WP_001802667.1.61324 WP_001802667.1.61327 WP_001802667.1.61339 WP_001802667.1.61346 WP_001802667.1.61353 WP_001802667.1.6136 WP_001802667.1.61375 WP_001802667.1.61394 WP_001802667.1.61408 WP_001802667.1.61413 WP_001802667.1.61421 WP_001802667.1.61430 WP_001802667.1.61439 WP_001802667.1.61440 WP_001802667.1.6149 WP_001802667.1.61515 WP_001802667.1.61534 WP_001802667.1.61547 WP_001802667.1.61555 WP_001802667.1.61564 WP_001802667.1.61585 WP_001802667.1.61591 WP_001802667.1.61597 WP_001802667.1.61615 WP_001802667.1.61639 WP_001802667.1.61641 WP_001802667.1.61653 WP_001802667.1.6166 WP_001802667.1.6168 WP_001802667.1.61687 WP_001802667.1.6170 WP_001802667.1.61705 WP_001802667.1.61709 WP_001802667.1.61713 WP_001802667.1.61747 WP_001802667.1.61749 WP_001802667.1.61776 WP_001802667.1.61784 WP_001802667.1.61800 WP_001802667.1.61802 WP_001802667.1.61831 WP_001802667.1.61838 WP_001802667.1.61864 WP_001802667.1.6188 WP_001802667.1.6189 WP_001802667.1.61897 WP_001802667.1.61899 WP_001802667.1.61903 WP_001802667.1.61910 WP_001802667.1.61921 WP_001802667.1.61936 WP_001802667.1.61962 WP_001802667.1.61970 WP_001802667.1.61975 WP_001802667.1.61976 WP_001802667.1.61978 WP_001802667.1.62002 WP_001802667.1.6201 WP_001802667.1.62028 WP_001802667.1.62030 WP_001802667.1.62069 WP_001802667.1.62071 WP_001802667.1.62084 WP_001802667.1.62085 WP_001802667.1.62088 WP_001802667.1.62093 WP_001802667.1.62096 WP_001802667.1.62127 WP_001802667.1.62140 WP_001802667.1.62160 WP_001802667.1.62164 WP_001802667.1.62229 WP_001802667.1.62247 WP_001802667.1.62253 WP_001802667.1.62254 WP_001802667.1.62265 WP_001802667.1.62318 WP_001802667.1.6234 WP_001802667.1.62346 WP_001802667.1.62352 WP_001802667.1.62367 WP_001802667.1.62382 WP_001802667.1.62383 WP_001802667.1.62392 WP_001802667.1.62398 WP_001802667.1.62409 WP_001802667.1.62414 WP_001802667.1.62429 WP_001802667.1.62437 WP_001802667.1.62453 WP_001802667.1.62459 WP_001802667.1.62462 WP_001802667.1.62474 WP_001802667.1.62482 WP_001802667.1.62492 WP_001802667.1.62496 WP_001802667.1.6250 WP_001802667.1.62539 WP_001802667.1.62553 WP_001802667.1.62563 WP_001802667.1.62575 WP_001802667.1.62602 WP_001802667.1.62608 WP_001802667.1.62621 WP_001802667.1.62625 WP_001802667.1.62630 WP_001802667.1.62653 WP_001802667.1.6266 WP_001802667.1.62671 WP_001802667.1.62674 WP_001802667.1.6268 WP_001802667.1.62684 WP_001802667.1.62685 WP_001802667.1.62723 WP_001802667.1.62740 WP_001802667.1.62756 WP_001802667.1.62764 WP_001802667.1.62781 WP_001802667.1.62796 WP_001802667.1.62808 WP_001802667.1.62822 WP_001802667.1.62824 WP_001802667.1.62829 WP_001802667.1.62831 WP_001802667.1.62842 WP_001802667.1.62863 WP_001802667.1.62878 WP_001802667.1.62880 WP_001802667.1.62925 WP_001802667.1.62927 WP_001802667.1.62956 WP_001802667.1.62970 WP_001802667.1.62974 WP_001802667.1.6298 WP_001802667.1.62998 WP_001802667.1.63003 WP_001802667.1.63004 WP_001802667.1.63011 WP_001802667.1.63021 WP_001802667.1.63027 WP_001802667.1.63047 WP_001802667.1.63050 WP_001802667.1.63051 WP_001802667.1.63062 WP_001802667.1.63068 WP_001802667.1.63070 WP_001802667.1.63083 WP_001802667.1.63085 WP_001802667.1.631 WP_001802667.1.63107 WP_001802667.1.63120 WP_001802667.1.63131 WP_001802667.1.63132 WP_001802667.1.63139 WP_001802667.1.63140 WP_001802667.1.63142 WP_001802667.1.63143 WP_001802667.1.63162 WP_001802667.1.63170 WP_001802667.1.63182 WP_001802667.1.63190 WP_001802667.1.63195 WP_001802667.1.63215 WP_001802667.1.63220 WP_001802667.1.63228 WP_001802667.1.63233 WP_001802667.1.63244 WP_001802667.1.63255 WP_001802667.1.63266 WP_001802667.1.63273 WP_001802667.1.63279 WP_001802667.1.63280 WP_001802667.1.63288 WP_001802667.1.63289 WP_001802667.1.63296 WP_001802667.1.63304 WP_001802667.1.63307 WP_001802667.1.63313 WP_001802667.1.63319 WP_001802667.1.63324 WP_001802667.1.63333 WP_001802667.1.63335 WP_001802667.1.63337 WP_001802667.1.63341 WP_001802667.1.63364 WP_001802667.1.63365 WP_001802667.1.634 WP_001802667.1.63406 WP_001802667.1.63411 WP_001802667.1.63421 WP_001802667.1.63441 WP_001802667.1.63460 WP_001802667.1.63469 WP_001802667.1.63471 WP_001802667.1.63510 WP_001802667.1.63527 WP_001802667.1.63540 WP_001802667.1.6355 WP_001802667.1.63565 WP_001802667.1.63589 WP_001802667.1.63617 WP_001802667.1.63635 WP_001802667.1.63672 WP_001802667.1.63673 WP_001802667.1.63678 WP_001802667.1.63693 WP_001802667.1.63704 WP_001802667.1.63705 WP_001802667.1.63726 WP_001802667.1.63729 WP_001802667.1.63751 WP_001802667.1.63759 WP_001802667.1.63760 WP_001802667.1.63763 WP_001802667.1.63774 WP_001802667.1.6378 WP_001802667.1.63847 WP_001802667.1.63874 WP_001802667.1.63878 WP_001802667.1.6388 WP_001802667.1.63890 WP_001802667.1.63894 WP_001802667.1.63895 WP_001802667.1.63907 WP_001802667.1.63910 WP_001802667.1.63923 WP_001802667.1.63937 WP_001802667.1.63975 WP_001802667.1.63987 WP_001802667.1.63998 WP_001802667.1.64012 WP_001802667.1.6403 WP_001802667.1.64060 WP_001802667.1.6408 WP_001802667.1.64094 WP_001802667.1.64105 WP_001802667.1.64108 WP_001802667.1.6412 WP_001802667.1.64127 WP_001802667.1.64181 WP_001802667.1.64192 WP_001802667.1.642 WP_001802667.1.64207 WP_001802667.1.64230 WP_001802667.1.64232 WP_001802667.1.64234 WP_001802667.1.64250 WP_001802667.1.64251 WP_001802667.1.64288 WP_001802667.1.64303 WP_001802667.1.64304 WP_001802667.1.64334 WP_001802667.1.64351 WP_001802667.1.64367 WP_001802667.1.64368 WP_001802667.1.6438 WP_001802667.1.64396 WP_001802667.1.64397 WP_001802667.1.64400 WP_001802667.1.64408 WP_001802667.1.64434 WP_001802667.1.64440 WP_001802667.1.64446 WP_001802667.1.64456 WP_001802667.1.64457 WP_001802667.1.645 WP_001802667.1.64525 WP_001802667.1.6453 WP_001802667.1.64537 WP_001802667.1.64549 WP_001802667.1.64565 WP_001802667.1.64583 WP_001802667.1.6459 WP_001802667.1.64598 WP_001802667.1.6462 WP_001802667.1.64628 WP_001802667.1.64630 WP_001802667.1.64631 WP_001802667.1.64643 WP_001802667.1.64665 WP_001802667.1.64677 WP_001802667.1.64686 WP_001802667.1.64720 WP_001802667.1.64765 WP_001802667.1.6479 WP_001802667.1.64811 WP_001802667.1.64845 WP_001802667.1.64858 WP_001802667.1.64860 WP_001802667.1.64873 WP_001802667.1.64879 WP_001802667.1.6488 WP_001802667.1.64893 WP_001802667.1.64896 WP_001802667.1.64897 WP_001802667.1.64899 WP_001802667.1.64911 WP_001802667.1.64928 WP_001802667.1.64935 WP_001802667.1.64951 WP_001802667.1.64956 WP_001802667.1.64961 WP_001802667.1.64988 WP_001802667.1.64994 WP_001802667.1.64996 WP_001802667.1.64998 WP_001802667.1.65025 WP_001802667.1.65033 WP_001802667.1.65038 WP_001802667.1.65044 WP_001802667.1.65046 WP_001802667.1.65076 WP_001802667.1.65082 WP_001802667.1.6509 WP_001802667.1.65125 WP_001802667.1.65132 WP_001802667.1.65153 WP_001802667.1.65156 WP_001802667.1.65158 WP_001802667.1.65164 WP_001802667.1.65180 WP_001802667.1.65193 WP_001802667.1.65203 WP_001802667.1.65214 WP_001802667.1.65217 WP_001802667.1.65233 WP_001802667.1.65243 WP_001802667.1.65259 WP_001802667.1.65264 WP_001802667.1.65274 WP_001802667.1.6531 WP_001802667.1.65317 WP_001802667.1.65346 WP_001802667.1.65358 WP_001802667.1.65361 WP_001802667.1.65367 WP_001802667.1.65387 WP_001802667.1.65406 WP_001802667.1.65407 WP_001802667.1.65419 WP_001802667.1.65423 WP_001802667.1.65432 WP_001802667.1.6544 WP_001802667.1.65443 WP_001802667.1.65448 WP_001802667.1.65451 WP_001802667.1.6547 WP_001802667.1.65470 WP_001802667.1.65504 WP_001802667.1.6551 WP_001802667.1.65512 WP_001802667.1.65520 WP_001802667.1.65541 WP_001802667.1.65544 WP_001802667.1.65555 WP_001802667.1.65562 WP_001802667.1.65585 WP_001802667.1.6559 WP_001802667.1.65599 WP_001802667.1.65600 WP_001802667.1.65616 WP_001802667.1.65629 WP_001802667.1.65643 WP_001802667.1.65653 WP_001802667.1.65656 WP_001802667.1.65663 WP_001802667.1.65675 WP_001802667.1.6568 WP_001802667.1.65689 WP_001802667.1.65693 WP_001802667.1.65700 WP_001802667.1.65703 WP_001802667.1.65704 WP_001802667.1.65705 WP_001802667.1.65713 WP_001802667.1.65734 WP_001802667.1.65750 WP_001802667.1.65752 WP_001802667.1.65769 WP_001802667.1.6578 WP_001802667.1.65808 WP_001802667.1.65809 WP_001802667.1.65842 WP_001802667.1.6585 WP_001802667.1.65856 WP_001802667.1.65870 WP_001802667.1.65892 WP_001802667.1.65922 WP_001802667.1.65928 WP_001802667.1.65930 WP_001802667.1.65931 WP_001802667.1.65935 WP_001802667.1.65946 WP_001802667.1.65947 WP_001802667.1.65948 WP_001802667.1.65965 WP_001802667.1.65986 WP_001802667.1.66009 WP_001802667.1.66014 WP_001802667.1.6603 WP_001802667.1.66035 WP_001802667.1.66054 WP_001802667.1.66056 WP_001802667.1.66069 WP_001802667.1.66073 WP_001802667.1.66081 WP_001802667.1.661 WP_001802667.1.6612 WP_001802667.1.66120 WP_001802667.1.66130 WP_001802667.1.66133 WP_001802667.1.66144 WP_001802667.1.66175 WP_001802667.1.66227 WP_001802667.1.66262 WP_001802667.1.66265 WP_001802667.1.66281 WP_001802667.1.66287 WP_001802667.1.66298 WP_001802667.1.66302 WP_001802667.1.6632 WP_001802667.1.66322 WP_001802667.1.66328 WP_001802667.1.66366 WP_001802667.1.66369 WP_001802667.1.66433 WP_001802667.1.66453 WP_001802667.1.66482 WP_001802667.1.66505 WP_001802667.1.66513 WP_001802667.1.66518 WP_001802667.1.66519 WP_001802667.1.66542 WP_001802667.1.66554 WP_001802667.1.66556 WP_001802667.1.66564 WP_001802667.1.66576 WP_001802667.1.66588 WP_001802667.1.66598 WP_001802667.1.66601 WP_001802667.1.66606 WP_001802667.1.66614 WP_001802667.1.6662 WP_001802667.1.66628 WP_001802667.1.66655 WP_001802667.1.66664 WP_001802667.1.66677 WP_001802667.1.6668 WP_001802667.1.66690 WP_001802667.1.66705 WP_001802667.1.66711 WP_001802667.1.66712 WP_001802667.1.66726 WP_001802667.1.6674 WP_001802667.1.66756 WP_001802667.1.66765 WP_001802667.1.66766 WP_001802667.1.66786 WP_001802667.1.66792 WP_001802667.1.66803 WP_001802667.1.66816 WP_001802667.1.66818 WP_001802667.1.6684 WP_001802667.1.66853 WP_001802667.1.66879 WP_001802667.1.6688 WP_001802667.1.66906 WP_001802667.1.66938 WP_001802667.1.66969 WP_001802667.1.66979 WP_001802667.1.66996 WP_001802667.1.6700 WP_001802667.1.67006 WP_001802667.1.67012 WP_001802667.1.67014 WP_001802667.1.67016 WP_001802667.1.67067 WP_001802667.1.67072 WP_001802667.1.67090 WP_001802667.1.67112 WP_001802667.1.67113 WP_001802667.1.67135 WP_001802667.1.67147 WP_001802667.1.67152 WP_001802667.1.67155 WP_001802667.1.67160 WP_001802667.1.67191 WP_001802667.1.67204 WP_001802667.1.67212 WP_001802667.1.6722 WP_001802667.1.67238 WP_001802667.1.67251 WP_001802667.1.67259 WP_001802667.1.6726 WP_001802667.1.67266 WP_001802667.1.67286 WP_001802667.1.67294 WP_001802667.1.67296 WP_001802667.1.67297 WP_001802667.1.67312 WP_001802667.1.67328 WP_001802667.1.67329 WP_001802667.1.67333 WP_001802667.1.67375 WP_001802667.1.67379 WP_001802667.1.67384 WP_001802667.1.67386 WP_001802667.1.6740 WP_001802667.1.67414 WP_001802667.1.67418 WP_001802667.1.67420 WP_001802667.1.67425 WP_001802667.1.67447 WP_001802667.1.67457 WP_001802667.1.67460 WP_001802667.1.67463 WP_001802667.1.67480 WP_001802667.1.67505 WP_001802667.1.67507 WP_001802667.1.67513 WP_001802667.1.67520 WP_001802667.1.67521 WP_001802667.1.67540 WP_001802667.1.67554 WP_001802667.1.67571 WP_001802667.1.67572 WP_001802667.1.67609 WP_001802667.1.67612 WP_001802667.1.67618 WP_001802667.1.67620 WP_001802667.1.67621 WP_001802667.1.67632 WP_001802667.1.67644 WP_001802667.1.67651 WP_001802667.1.67652 WP_001802667.1.67653 WP_001802667.1.67691 WP_001802667.1.67703 WP_001802667.1.67712 WP_001802667.1.67713 WP_001802667.1.67722 WP_001802667.1.67752 WP_001802667.1.67754 WP_001802667.1.67762 WP_001802667.1.67767 WP_001802667.1.67798 WP_001802667.1.67800 WP_001802667.1.67806 WP_001802667.1.67808 WP_001802667.1.67815 WP_001802667.1.67834 WP_001802667.1.6786 WP_001802667.1.67864 WP_001802667.1.67865 WP_001802667.1.67867 WP_001802667.1.67880 WP_001802667.1.67889 WP_001802667.1.67900 WP_001802667.1.67925 WP_001802667.1.67931 WP_001802667.1.67941 WP_001802667.1.67986 WP_001802667.1.67991 WP_001802667.1.68001 WP_001802667.1.68020 WP_001802667.1.68033 WP_001802667.1.68054 WP_001802667.1.68066 WP_001802667.1.68101 WP_001802667.1.68102 WP_001802667.1.6811 WP_001802667.1.68111 WP_001802667.1.68134 WP_001802667.1.68139 WP_001802667.1.68141 WP_001802667.1.68152 WP_001802667.1.68160 WP_001802667.1.68161 WP_001802667.1.68199 WP_001802667.1.68202 WP_001802667.1.68219 WP_001802667.1.68221 WP_001802667.1.68223 WP_001802667.1.68233 WP_001802667.1.6824 WP_001802667.1.68261 WP_001802667.1.68268 WP_001802667.1.68286 WP_001802667.1.68295 WP_001802667.1.68296 WP_001802667.1.68299 WP_001802667.1.6830 WP_001802667.1.68307 WP_001802667.1.68334 WP_001802667.1.6834 WP_001802667.1.68343 WP_001802667.1.68351 WP_001802667.1.68355 WP_001802667.1.68366 WP_001802667.1.68367 WP_001802667.1.6839 WP_001802667.1.68392 WP_001802667.1.68397 WP_001802667.1.68398 WP_001802667.1.68399 WP_001802667.1.68404 WP_001802667.1.68416 WP_001802667.1.68425 WP_001802667.1.68466 WP_001802667.1.68476 WP_001802667.1.68479 WP_001802667.1.68483 WP_001802667.1.68489 WP_001802667.1.68504 WP_001802667.1.68505 WP_001802667.1.68512 WP_001802667.1.68522 WP_001802667.1.68542 WP_001802667.1.68548 WP_001802667.1.68565 WP_001802667.1.68575 WP_001802667.1.686 WP_001802667.1.68636 WP_001802667.1.68650 WP_001802667.1.68657 WP_001802667.1.68681 WP_001802667.1.68683 WP_001802667.1.68699 WP_001802667.1.68703 WP_001802667.1.68716 WP_001802667.1.68728 WP_001802667.1.68737 WP_001802667.1.68741 WP_001802667.1.68743 WP_001802667.1.68747 WP_001802667.1.68773 WP_001802667.1.68775 WP_001802667.1.68813 WP_001802667.1.68831 WP_001802667.1.68854 WP_001802667.1.68864 WP_001802667.1.68875 WP_001802667.1.68878 WP_001802667.1.68883 WP_001802667.1.68917 WP_001802667.1.68931 WP_001802667.1.68943 WP_001802667.1.68944 WP_001802667.1.68987 WP_001802667.1.68998 WP_001802667.1.69012 WP_001802667.1.69016 WP_001802667.1.69045 WP_001802667.1.69071 WP_001802667.1.69078 WP_001802667.1.69087 WP_001802667.1.69089 WP_001802667.1.691 WP_001802667.1.69105 WP_001802667.1.69110 WP_001802667.1.69111 WP_001802667.1.69120 WP_001802667.1.69125 WP_001802667.1.69147 WP_001802667.1.6915 WP_001802667.1.69162 WP_001802667.1.6917 WP_001802667.1.69179 WP_001802667.1.69191 WP_001802667.1.69198 WP_001802667.1.69213 WP_001802667.1.69219 WP_001802667.1.69222 WP_001802667.1.69232 WP_001802667.1.69237 WP_001802667.1.69239 WP_001802667.1.69251 WP_001802667.1.69266 WP_001802667.1.69280 WP_001802667.1.69314 WP_001802667.1.69349 WP_001802667.1.69361 WP_001802667.1.69366 WP_001802667.1.69378 WP_001802667.1.69394 WP_001802667.1.69395 WP_001802667.1.69409 WP_001802667.1.69412 WP_001802667.1.69415 WP_001802667.1.69434 WP_001802667.1.69437 WP_001802667.1.69446 WP_001802667.1.69475 WP_001802667.1.69476 WP_001802667.1.69477 WP_001802667.1.69480 WP_001802667.1.69483 WP_001802667.1.69484 WP_001802667.1.69489 WP_001802667.1.69490 WP_001802667.1.695 WP_001802667.1.69520 WP_001802667.1.6953 WP_001802667.1.69546 WP_001802667.1.69559 WP_001802667.1.69563 WP_001802667.1.69598 WP_001802667.1.69622 WP_001802667.1.69639 WP_001802667.1.69679 WP_001802667.1.6968 WP_001802667.1.69683 WP_001802667.1.69685 WP_001802667.1.69718 WP_001802667.1.69721 WP_001802667.1.69724 WP_001802667.1.69734 WP_001802667.1.6980 WP_001802667.1.69820 WP_001802667.1.69823 WP_001802667.1.69830 WP_001802667.1.69842 WP_001802667.1.69877 WP_001802667.1.69878 WP_001802667.1.69882 WP_001802667.1.699 WP_001802667.1.69902 WP_001802667.1.69921 WP_001802667.1.69934 WP_001802667.1.69980 WP_001802667.1.69987 WP_001802667.1.69995 WP_001802667.1.70024 WP_001802667.1.70048 WP_001802667.1.70059 WP_001802667.1.70105 WP_001802667.1.7012 WP_001802667.1.70133 WP_001802667.1.70161 WP_001802667.1.70210 WP_001802667.1.70220 WP_001802667.1.70225 WP_001802667.1.70228 WP_001802667.1.7024 WP_001802667.1.70253 WP_001802667.1.70266 WP_001802667.1.70273 WP_001802667.1.70294 WP_001802667.1.703 WP_001802667.1.7030 WP_001802667.1.70311 WP_001802667.1.70313 WP_001802667.1.70334 WP_001802667.1.70338 WP_001802667.1.7034 WP_001802667.1.70344 WP_001802667.1.70349 WP_001802667.1.70353 WP_001802667.1.70361 WP_001802667.1.70389 WP_001802667.1.70413 WP_001802667.1.7043 WP_001802667.1.70438 WP_001802667.1.70441 WP_001802667.1.70448 WP_001802667.1.70451 WP_001802667.1.70457 WP_001802667.1.70459 WP_001802667.1.7046 WP_001802667.1.70462 WP_001802667.1.70487 WP_001802667.1.70495 WP_001802667.1.70527 WP_001802667.1.7053 WP_001802667.1.70541 WP_001802667.1.70546 WP_001802667.1.70554 WP_001802667.1.70558 WP_001802667.1.70564 WP_001802667.1.70572 WP_001802667.1.706 WP_001802667.1.7061 WP_001802667.1.70611 WP_001802667.1.70635 WP_001802667.1.7064 WP_001802667.1.70641 WP_001802667.1.70651 WP_001802667.1.7067 WP_001802667.1.70672 WP_001802667.1.707 WP_001802667.1.7071 WP_001802667.1.70721 WP_001802667.1.7073 WP_001802667.1.70763 WP_001802667.1.70790 WP_001802667.1.70791 WP_001802667.1.70808 WP_001802667.1.70818 WP_001802667.1.70823 WP_001802667.1.70829 WP_001802667.1.70835 WP_001802667.1.70843 WP_001802667.1.70850 WP_001802667.1.70855 WP_001802667.1.7089 WP_001802667.1.70909 WP_001802667.1.70917 WP_001802667.1.70924 WP_001802667.1.70926 WP_001802667.1.70930 WP_001802667.1.70939 WP_001802667.1.70943 WP_001802667.1.70994 WP_001802667.1.710 WP_001802667.1.71027 WP_001802667.1.71043 WP_001802667.1.7105 WP_001802667.1.71058 WP_001802667.1.71059 WP_001802667.1.71073 WP_001802667.1.7109 WP_001802667.1.711 WP_001802667.1.71130 WP_001802667.1.71143 WP_001802667.1.71179 WP_001802667.1.71180 WP_001802667.1.71182 WP_001802667.1.7119 WP_001802667.1.71196 WP_001802667.1.7120 WP_001802667.1.71208 WP_001802667.1.71231 WP_001802667.1.71236 WP_001802667.1.7125 WP_001802667.1.71256 WP_001802667.1.71257 WP_001802667.1.71267 WP_001802667.1.71280 WP_001802667.1.71295 WP_001802667.1.71298 WP_001802667.1.71301 WP_001802667.1.71313 WP_001802667.1.71316 WP_001802667.1.71325 WP_001802667.1.71332 WP_001802667.1.71345 WP_001802667.1.71351 WP_001802667.1.71359 WP_001802667.1.71404 WP_001802667.1.71416 WP_001802667.1.71419 WP_001802667.1.71428 WP_001802667.1.71431 WP_001802667.1.71463 WP_001802667.1.71466 WP_001802667.1.71467 WP_001802667.1.71475 WP_001802667.1.71483 WP_001802667.1.7150 WP_001802667.1.71519 WP_001802667.1.71521 WP_001802667.1.71529 WP_001802667.1.71541 WP_001802667.1.71543 WP_001802667.1.71547 WP_001802667.1.71572 WP_001802667.1.7158 WP_001802667.1.71590 WP_001802667.1.71596 WP_001802667.1.71602 WP_001802667.1.7161 WP_001802667.1.7164 WP_001802667.1.71644 WP_001802667.1.71662 WP_001802667.1.71676 WP_001802667.1.71707 WP_001802667.1.71715 WP_001802667.1.71721 WP_001802667.1.71735 WP_001802667.1.71737 WP_001802667.1.71739 WP_001802667.1.71741 WP_001802667.1.71771 WP_001802667.1.71772 WP_001802667.1.71780 WP_001802667.1.71788 WP_001802667.1.7179 WP_001802667.1.71800 WP_001802667.1.71828 WP_001802667.1.71836 WP_001802667.1.71859 WP_001802667.1.71861 WP_001802667.1.71863 WP_001802667.1.71877 WP_001802667.1.71888 WP_001802667.1.71892 WP_001802667.1.71910 WP_001802667.1.71925 WP_001802667.1.7193 WP_001802667.1.71949 WP_001802667.1.71978 WP_001802667.1.7198 WP_001802667.1.71981 WP_001802667.1.71989 WP_001802667.1.72002 WP_001802667.1.72018 WP_001802667.1.72026 WP_001802667.1.72031 WP_001802667.1.72035 WP_001802667.1.72067 WP_001802667.1.72085 WP_001802667.1.72089 WP_001802667.1.72099 WP_001802667.1.72102 WP_001802667.1.72112 WP_001802667.1.72148 WP_001802667.1.72169 WP_001802667.1.72176 WP_001802667.1.722 WP_001802667.1.72204 WP_001802667.1.72205 WP_001802667.1.72224 WP_001802667.1.72257 WP_001802667.1.72271 WP_001802667.1.72285 WP_001802667.1.72306 WP_001802667.1.72315 WP_001802667.1.72330 WP_001802667.1.72340 WP_001802667.1.72347 WP_001802667.1.7236 WP_001802667.1.72363 WP_001802667.1.72366 WP_001802667.1.72371 WP_001802667.1.7242 WP_001802667.1.72424 WP_001802667.1.72433 WP_001802667.1.72446 WP_001802667.1.72453 WP_001802667.1.72465 WP_001802667.1.72478 WP_001802667.1.72489 WP_001802667.1.72496 WP_001802667.1.72497 WP_001802667.1.72529 WP_001802667.1.7254 WP_001802667.1.72547 WP_001802667.1.72564 WP_001802667.1.7258 WP_001802667.1.7260 WP_001802667.1.72626 WP_001802667.1.72649 WP_001802667.1.72654 WP_001802667.1.72666 WP_001802667.1.72708 WP_001802667.1.72719 WP_001802667.1.72750 WP_001802667.1.72753 WP_001802667.1.72760 WP_001802667.1.72762 WP_001802667.1.7278 WP_001802667.1.72787 WP_001802667.1.72816 WP_001802667.1.72832 WP_001802667.1.72834 WP_001802667.1.72835 WP_001802667.1.72874 WP_001802667.1.72881 WP_001802667.1.72903 WP_001802667.1.72904 WP_001802667.1.7292 WP_001802667.1.72930 WP_001802667.1.72935 WP_001802667.1.7294 WP_001802667.1.72945 WP_001802667.1.72961 WP_001802667.1.72965 WP_001802667.1.72991 WP_001802667.1.73002 WP_001802667.1.73004 WP_001802667.1.73017 WP_001802667.1.73019 WP_001802667.1.73021 WP_001802667.1.73022 WP_001802667.1.73037 WP_001802667.1.73046 WP_001802667.1.73074 WP_001802667.1.73087 WP_001802667.1.73121 WP_001802667.1.73122 WP_001802667.1.73132 WP_001802667.1.73140 WP_001802667.1.73190 WP_001802667.1.73195 WP_001802667.1.73201 WP_001802667.1.73211 WP_001802667.1.73240 WP_001802667.1.73241 WP_001802667.1.73246 WP_001802667.1.7326 WP_001802667.1.73264 WP_001802667.1.73265 WP_001802667.1.73286 WP_001802667.1.73312 WP_001802667.1.73386 WP_001802667.1.73401 WP_001802667.1.73420 WP_001802667.1.73444 WP_001802667.1.73450 WP_001802667.1.73456 WP_001802667.1.73464 WP_001802667.1.73467 WP_001802667.1.73489 WP_001802667.1.73501 WP_001802667.1.73513 WP_001802667.1.73526 WP_001802667.1.73536 WP_001802667.1.73539 WP_001802667.1.73547 WP_001802667.1.73571 WP_001802667.1.73591 WP_001802667.1.736 WP_001802667.1.7360 WP_001802667.1.73610 WP_001802667.1.73639 WP_001802667.1.73640 WP_001802667.1.7365 WP_001802667.1.73674 WP_001802667.1.73685 WP_001802667.1.73687 WP_001802667.1.73693 WP_001802667.1.73694 WP_001802667.1.73733 WP_001802667.1.73735 WP_001802667.1.73736 WP_001802667.1.73740 WP_001802667.1.73759 WP_001802667.1.73786 WP_001802667.1.73789 WP_001802667.1.7380 WP_001802667.1.73834 WP_001802667.1.73837 WP_001802667.1.73853 WP_001802667.1.73868 WP_001802667.1.73880 WP_001802667.1.73885 WP_001802667.1.73900 WP_001802667.1.73902 WP_001802667.1.73910 WP_001802667.1.73920 WP_001802667.1.73921 WP_001802667.1.73940 WP_001802667.1.73949 WP_001802667.1.73961 WP_001802667.1.73969 WP_001802667.1.73971 WP_001802667.1.73976 WP_001802667.1.73983 WP_001802667.1.74004 WP_001802667.1.74006 WP_001802667.1.7401 WP_001802667.1.74010 WP_001802667.1.74013 WP_001802667.1.74025 WP_001802667.1.74027 WP_001802667.1.7406 WP_001802667.1.74073 WP_001802667.1.74081 WP_001802667.1.74085 WP_001802667.1.74088 WP_001802667.1.74155 WP_001802667.1.74157 WP_001802667.1.74158 WP_001802667.1.74161 WP_001802667.1.74172 WP_001802667.1.74173 WP_001802667.1.7418 WP_001802667.1.74183 WP_001802667.1.74187 WP_001802667.1.74201 WP_001802667.1.74216 WP_001802667.1.74221 WP_001802667.1.74234 WP_001802667.1.74237 WP_001802667.1.74242 WP_001802667.1.74257 WP_001802667.1.7427 WP_001802667.1.7428 WP_001802667.1.74284 WP_001802667.1.74295 WP_001802667.1.74327 WP_001802667.1.74338 WP_001802667.1.7434 WP_001802667.1.74353 WP_001802667.1.74356 WP_001802667.1.74380 WP_001802667.1.74390 WP_001802667.1.74429 WP_001802667.1.74456 WP_001802667.1.74457 WP_001802667.1.74468 WP_001802667.1.74474 WP_001802667.1.74486 WP_001802667.1.74497 WP_001802667.1.74556 WP_001802667.1.7457 WP_001802667.1.74576 WP_001802667.1.74587 WP_001802667.1.74590 WP_001802667.1.74610 WP_001802667.1.74638 WP_001802667.1.74676 WP_001802667.1.74681 WP_001802667.1.74693 WP_001802667.1.74696 WP_001802667.1.74704 WP_001802667.1.74731 WP_001802667.1.74747 WP_001802667.1.74758 WP_001802667.1.74761 WP_001802667.1.74770 WP_001802667.1.74775 WP_001802667.1.74781 WP_001802667.1.74785 WP_001802667.1.74797 WP_001802667.1.74802 WP_001802667.1.74808 WP_001802667.1.7482 WP_001802667.1.74840 WP_001802667.1.74846 WP_001802667.1.74849 WP_001802667.1.74866 WP_001802667.1.74874 WP_001802667.1.74890 WP_001802667.1.74899 WP_001802667.1.74911 WP_001802667.1.74922 WP_001802667.1.74924 WP_001802667.1.74961 WP_001802667.1.74963 WP_001802667.1.74978 WP_001802667.1.74985 WP_001802667.1.74994 WP_001802667.1.74999 WP_001802667.1.7500 WP_001802667.1.75006 WP_001802667.1.75038 WP_001802667.1.75044 WP_001802667.1.75052 WP_001802667.1.75070 WP_001802667.1.75091 WP_001802667.1.75093 WP_001802667.1.75111 WP_001802667.1.75122 WP_001802667.1.75131 WP_001802667.1.75132 WP_001802667.1.75141 WP_001802667.1.75186 WP_001802667.1.75227 WP_001802667.1.75252 WP_001802667.1.75253 WP_001802667.1.75294 WP_001802667.1.75298 WP_001802667.1.75304 WP_001802667.1.75320 WP_001802667.1.75323 WP_001802667.1.75327 WP_001802667.1.75349 WP_001802667.1.75351 WP_001802667.1.75356 WP_001802667.1.75365 WP_001802667.1.75369 WP_001802667.1.75375 WP_001802667.1.75379 WP_001802667.1.75399 WP_001802667.1.75409 WP_001802667.1.75411 WP_001802667.1.7542 WP_001802667.1.75438 WP_001802667.1.75440 WP_001802667.1.75481 WP_001802667.1.75506 WP_001802667.1.75509 WP_001802667.1.75521 WP_001802667.1.75527 WP_001802667.1.75538 WP_001802667.1.75542 WP_001802667.1.75551 WP_001802667.1.75566 WP_001802667.1.75571 WP_001802667.1.75590 WP_001802667.1.7561 WP_001802667.1.75623 WP_001802667.1.75649 WP_001802667.1.75652 WP_001802667.1.75680 WP_001802667.1.75685 WP_001802667.1.75692 WP_001802667.1.75704 WP_001802667.1.75728 WP_001802667.1.75743 WP_001802667.1.75769 WP_001802667.1.75770 WP_001802667.1.75775 WP_001802667.1.758 WP_001802667.1.75800 WP_001802667.1.75805 WP_001802667.1.75809 WP_001802667.1.75824 WP_001802667.1.75830 WP_001802667.1.7584 WP_001802667.1.75840 WP_001802667.1.75848 WP_001802667.1.75851 WP_001802667.1.75856 WP_001802667.1.75862 WP_001802667.1.75879 WP_001802667.1.75881 WP_001802667.1.75885 WP_001802667.1.75910 WP_001802667.1.75929 WP_001802667.1.75944 WP_001802667.1.75952 WP_001802667.1.75956 WP_001802667.1.75969 WP_001802667.1.76010 WP_001802667.1.76013 WP_001802667.1.76015 WP_001802667.1.7602 WP_001802667.1.76047 WP_001802667.1.76049 WP_001802667.1.76050 WP_001802667.1.76053 WP_001802667.1.7607 WP_001802667.1.76071 WP_001802667.1.76073 WP_001802667.1.76095 WP_001802667.1.76104 WP_001802667.1.76111 WP_001802667.1.76112 WP_001802667.1.76114 WP_001802667.1.76121 WP_001802667.1.76123 WP_001802667.1.76136 WP_001802667.1.76143 WP_001802667.1.76149 WP_001802667.1.76153 WP_001802667.1.76179 WP_001802667.1.76185 WP_001802667.1.76230 WP_001802667.1.76234 WP_001802667.1.7624 WP_001802667.1.7625 WP_001802667.1.76258 WP_001802667.1.76261 WP_001802667.1.76282 WP_001802667.1.76283 WP_001802667.1.76294 WP_001802667.1.76295 WP_001802667.1.76313 WP_001802667.1.76323 WP_001802667.1.76332 WP_001802667.1.76333 WP_001802667.1.76337 WP_001802667.1.76351 WP_001802667.1.7638 WP_001802667.1.76419 WP_001802667.1.76420 WP_001802667.1.76421 WP_001802667.1.76424 WP_001802667.1.76426 WP_001802667.1.76431 WP_001802667.1.76463 WP_001802667.1.76497 WP_001802667.1.765 WP_001802667.1.76528 WP_001802667.1.7658 WP_001802667.1.76604 WP_001802667.1.76606 WP_001802667.1.76624 WP_001802667.1.76648 WP_001802667.1.76659 WP_001802667.1.76674 WP_001802667.1.76686 WP_001802667.1.76689 WP_001802667.1.76690 WP_001802667.1.76693 WP_001802667.1.76711 WP_001802667.1.76718 WP_001802667.1.7675 WP_001802667.1.76790 WP_001802667.1.76792 WP_001802667.1.76798 WP_001802667.1.768 WP_001802667.1.76803 WP_001802667.1.76816 WP_001802667.1.76820 WP_001802667.1.76825 WP_001802667.1.76829 WP_001802667.1.76839 WP_001802667.1.76845 WP_001802667.1.7686 WP_001802667.1.76867 WP_001802667.1.76876 WP_001802667.1.76878 WP_001802667.1.76895 WP_001802667.1.76897 WP_001802667.1.76920 WP_001802667.1.76921 WP_001802667.1.76937 WP_001802667.1.7694 WP_001802667.1.76944 WP_001802667.1.76952 WP_001802667.1.76998 WP_001802667.1.77013 WP_001802667.1.77020 WP_001802667.1.77027 WP_001802667.1.77031 WP_001802667.1.77041 WP_001802667.1.77043 WP_001802667.1.77050 WP_001802667.1.77060 WP_001802667.1.77062 WP_001802667.1.77069 WP_001802667.1.77072 WP_001802667.1.77112 WP_001802667.1.77137 WP_001802667.1.77145 WP_001802667.1.77158 WP_001802667.1.77176 WP_001802667.1.77183 WP_001802667.1.77187 WP_001802667.1.77190 WP_001802667.1.77203 WP_001802667.1.77229 WP_001802667.1.77256 WP_001802667.1.77259 WP_001802667.1.77297 WP_001802667.1.77298 WP_001802667.1.77305 WP_001802667.1.77315 WP_001802667.1.77331 WP_001802667.1.77346 WP_001802667.1.77354 WP_001802667.1.77359 WP_001802667.1.77388 WP_001802667.1.77416 WP_001802667.1.77426 WP_001802667.1.77446 WP_001802667.1.7745 WP_001802667.1.7746 WP_001802667.1.77460 WP_001802667.1.77489 WP_001802667.1.77497 WP_001802667.1.77498 WP_001802667.1.7752 WP_001802667.1.77520 WP_001802667.1.77527 WP_001802667.1.77532 WP_001802667.1.77533 WP_001802667.1.77536 WP_001802667.1.77572 WP_001802667.1.77583 WP_001802667.1.77603 WP_001802667.1.77606 WP_001802667.1.77650 WP_001802667.1.77674 WP_001802667.1.77733 WP_001802667.1.77735 WP_001802667.1.77738 WP_001802667.1.7774 WP_001802667.1.77743 WP_001802667.1.77745 WP_001802667.1.77763 WP_001802667.1.77791 WP_001802667.1.77805 WP_001802667.1.77814 WP_001802667.1.77818 WP_001802667.1.77822 WP_001802667.1.77827 WP_001802667.1.77832 WP_001802667.1.77848 WP_001802667.1.7785 WP_001802667.1.77858 WP_001802667.1.7786 WP_001802667.1.77860 WP_001802667.1.7787 WP_001802667.1.77882 WP_001802667.1.77883 WP_001802667.1.77893 WP_001802667.1.77896 WP_001802667.1.77908 WP_001802667.1.77915 WP_001802667.1.77922 WP_001802667.1.77930 WP_001802667.1.77952 WP_001802667.1.77957 WP_001802667.1.77986 WP_001802667.1.78002 WP_001802667.1.78038 WP_001802667.1.78050 WP_001802667.1.78054 WP_001802667.1.78067 WP_001802667.1.78082 WP_001802667.1.78091 WP_001802667.1.78095 WP_001802667.1.7810 WP_001802667.1.78116 WP_001802667.1.78126 WP_001802667.1.78164 WP_001802667.1.78173 WP_001802667.1.78179 WP_001802667.1.78185 WP_001802667.1.78189 WP_001802667.1.78194 WP_001802667.1.78207 WP_001802667.1.78208 WP_001802667.1.78210 WP_001802667.1.78252 WP_001802667.1.78254 WP_001802667.1.78257 WP_001802667.1.7827 WP_001802667.1.78304 WP_001802667.1.78311 WP_001802667.1.78324 WP_001802667.1.7833 WP_001802667.1.78330 WP_001802667.1.78332 WP_001802667.1.78335 WP_001802667.1.78365 WP_001802667.1.78371 WP_001802667.1.78392 WP_001802667.1.78404 WP_001802667.1.78434 WP_001802667.1.78436 WP_001802667.1.78458 WP_001802667.1.78470 WP_001802667.1.78478 WP_001802667.1.78489 WP_001802667.1.78494 WP_001802667.1.7850 WP_001802667.1.78513 WP_001802667.1.7853 WP_001802667.1.78550 WP_001802667.1.78558 WP_001802667.1.7857 WP_001802667.1.78573 WP_001802667.1.78582 WP_001802667.1.78585 WP_001802667.1.78592 WP_001802667.1.78596 WP_001802667.1.78598 WP_001802667.1.78604 WP_001802667.1.78625 WP_001802667.1.78633 WP_001802667.1.78638 WP_001802667.1.78653 WP_001802667.1.78662 WP_001802667.1.78667 WP_001802667.1.7868 WP_001802667.1.78685 WP_001802667.1.78708 WP_001802667.1.78728 WP_001802667.1.78731 WP_001802667.1.78736 WP_001802667.1.78763 WP_001802667.1.78785 WP_001802667.1.78803 WP_001802667.1.78816 WP_001802667.1.78819 WP_001802667.1.78841 WP_001802667.1.78872 WP_001802667.1.7888 WP_001802667.1.78897 WP_001802667.1.78920 WP_001802667.1.78934 WP_001802667.1.78937 WP_001802667.1.78946 WP_001802667.1.78978 WP_001802667.1.78983 WP_001802667.1.78985 WP_001802667.1.78991 WP_001802667.1.78995 WP_001802667.1.7900 WP_001802667.1.79006 WP_001802667.1.79037 WP_001802667.1.79038 WP_001802667.1.7905 WP_001802667.1.79051 WP_001802667.1.79059 WP_001802667.1.79085 WP_001802667.1.79110 WP_001802667.1.79114 WP_001802667.1.79131 WP_001802667.1.79132 WP_001802667.1.7914 WP_001802667.1.79143 WP_001802667.1.79156 WP_001802667.1.79170 WP_001802667.1.79178 WP_001802667.1.79192 WP_001802667.1.79197 WP_001802667.1.79208 WP_001802667.1.79223 WP_001802667.1.79227 WP_001802667.1.79270 WP_001802667.1.79275 WP_001802667.1.79285 WP_001802667.1.7930 WP_001802667.1.7931 WP_001802667.1.79310 WP_001802667.1.79314 WP_001802667.1.79320 WP_001802667.1.79322 WP_001802667.1.79332 WP_001802667.1.79334 WP_001802667.1.79341 WP_001802667.1.79367 WP_001802667.1.79374 WP_001802667.1.79378 WP_001802667.1.79379 WP_001802667.1.79400 WP_001802667.1.79407 WP_001802667.1.79408 WP_001802667.1.79436 WP_001802667.1.79452 WP_001802667.1.79461 WP_001802667.1.79473 WP_001802667.1.79476 WP_001802667.1.79487 WP_001802667.1.79539 WP_001802667.1.79543 WP_001802667.1.79552 WP_001802667.1.79554 WP_001802667.1.79556 WP_001802667.1.79566 WP_001802667.1.79581 WP_001802667.1.79626 WP_001802667.1.79627 WP_001802667.1.79638 WP_001802667.1.79646 WP_001802667.1.79662 WP_001802667.1.79664 WP_001802667.1.79672 WP_001802667.1.79676 WP_001802667.1.79677 WP_001802667.1.79706 WP_001802667.1.79731 WP_001802667.1.79737 WP_001802667.1.79763 WP_001802667.1.7981 WP_001802667.1.79810 WP_001802667.1.79815 WP_001802667.1.79822 WP_001802667.1.79831 WP_001802667.1.79834 WP_001802667.1.79837 WP_001802667.1.79854 WP_001802667.1.79855 WP_001802667.1.7989 WP_001802667.1.79896 WP_001802667.1.79904 WP_001802667.1.79911 WP_001802667.1.79919 WP_001802667.1.7992 WP_001802667.1.79941 WP_001802667.1.79949 WP_001802667.1.79961 WP_001802667.1.79971 WP_001802667.1.79991 WP_001802667.1.80000 WP_001802667.1.80009 WP_001802667.1.80013 WP_001802667.1.80029 WP_001802667.1.80032 WP_001802667.1.80034 WP_001802667.1.80042 WP_001802667.1.80079 WP_001802667.1.80086 WP_001802667.1.80109 WP_001802667.1.80119 WP_001802667.1.80120 WP_001802667.1.80122 WP_001802667.1.80124 WP_001802667.1.80127 WP_001802667.1.80146 WP_001802667.1.80147 WP_001802667.1.80152 WP_001802667.1.80159 WP_001802667.1.80178 WP_001802667.1.80181 WP_001802667.1.80184 WP_001802667.1.80193 WP_001802667.1.80203 WP_001802667.1.80206 WP_001802667.1.80210 WP_001802667.1.80244 WP_001802667.1.80274 WP_001802667.1.80286 WP_001802667.1.80287 WP_001802667.1.80290 WP_001802667.1.80297 WP_001802667.1.80303 WP_001802667.1.80308 WP_001802667.1.8031 WP_001802667.1.80316 WP_001802667.1.80317 WP_001802667.1.80318 WP_001802667.1.80345 WP_001802667.1.8035 WP_001802667.1.80358 WP_001802667.1.80361 WP_001802667.1.80378 WP_001802667.1.80389 WP_001802667.1.80393 WP_001802667.1.8040 WP_001802667.1.80414 WP_001802667.1.80430 WP_001802667.1.80434 WP_001802667.1.8045 WP_001802667.1.80472 WP_001802667.1.80482 WP_001802667.1.80521 WP_001802667.1.80530 WP_001802667.1.80582 WP_001802667.1.80647 WP_001802667.1.8065 WP_001802667.1.80653 WP_001802667.1.8066 WP_001802667.1.80680 WP_001802667.1.80687 WP_001802667.1.80717 WP_001802667.1.80734 WP_001802667.1.80745 WP_001802667.1.80761 WP_001802667.1.80762 WP_001802667.1.80763 WP_001802667.1.8077 WP_001802667.1.80781 WP_001802667.1.80793 WP_001802667.1.80801 WP_001802667.1.80828 WP_001802667.1.80833 WP_001802667.1.8084 WP_001802667.1.80845 WP_001802667.1.8085 WP_001802667.1.80872 WP_001802667.1.80899 WP_001802667.1.809 WP_001802667.1.80962 WP_001802667.1.80972 WP_001802667.1.80979 WP_001802667.1.80980 WP_001802667.1.81010 WP_001802667.1.81022 WP_001802667.1.81049 WP_001802667.1.81052 WP_001802667.1.81055 WP_001802667.1.81064 WP_001802667.1.81065 WP_001802667.1.81085 WP_001802667.1.81092 WP_001802667.1.81097 WP_001802667.1.81114 WP_001802667.1.81132 WP_001802667.1.81151 WP_001802667.1.81157 WP_001802667.1.81171 WP_001802667.1.81172 WP_001802667.1.81176 WP_001802667.1.81184 WP_001802667.1.81214 WP_001802667.1.81224 WP_001802667.1.81228 WP_001802667.1.81234 WP_001802667.1.81243 WP_001802667.1.8125 WP_001802667.1.81252 WP_001802667.1.81288 WP_001802667.1.81290 WP_001802667.1.81344 WP_001802667.1.8135 WP_001802667.1.81379 WP_001802667.1.81385 WP_001802667.1.81387 WP_001802667.1.81389 WP_001802667.1.8142 WP_001802667.1.81436 WP_001802667.1.8144 WP_001802667.1.81464 WP_001802667.1.81467 WP_001802667.1.81508 WP_001802667.1.81522 WP_001802667.1.81532 WP_001802667.1.81549 WP_001802667.1.81572 WP_001802667.1.81574 WP_001802667.1.81599 WP_001802667.1.8160 WP_001802667.1.81604 WP_001802667.1.81610 WP_001802667.1.81619 WP_001802667.1.81631 WP_001802667.1.81637 WP_001802667.1.81645 WP_001802667.1.81651 WP_001802667.1.81734 WP_001802667.1.81738 WP_001802667.1.81740 WP_001802667.1.81758 WP_001802667.1.8176 WP_001802667.1.81767 WP_001802667.1.81789 WP_001802667.1.8180 WP_001802667.1.81800 WP_001802667.1.81810 WP_001802667.1.81812 WP_001802667.1.81829 WP_001802667.1.81831 WP_001802667.1.81837 WP_001802667.1.81838 WP_001802667.1.81847 WP_001802667.1.8185 WP_001802667.1.81861 WP_001802667.1.81870 WP_001802667.1.8188 WP_001802667.1.81897 WP_001802667.1.81903 WP_001802667.1.81904 WP_001802667.1.81905 WP_001802667.1.81906 WP_001802667.1.81919 WP_001802667.1.81940 WP_001802667.1.81944 WP_001802667.1.81955 WP_001802667.1.81969 WP_001802667.1.81990 WP_001802667.1.81996 WP_001802667.1.81999 WP_001802667.1.82009 WP_001802667.1.82015 WP_001802667.1.82017 WP_001802667.1.82026 WP_001802667.1.82053 WP_001802667.1.82058 WP_001802667.1.8206 WP_001802667.1.82091 WP_001802667.1.82100 WP_001802667.1.82103 WP_001802667.1.8212 WP_001802667.1.82121 WP_001802667.1.8213 WP_001802667.1.82161 WP_001802667.1.82167 WP_001802667.1.82174 WP_001802667.1.82184 WP_001802667.1.82219 WP_001802667.1.82234 WP_001802667.1.82247 WP_001802667.1.82253 WP_001802667.1.82259 WP_001802667.1.82278 WP_001802667.1.82281 WP_001802667.1.82301 WP_001802667.1.82315 WP_001802667.1.82321 WP_001802667.1.82340 WP_001802667.1.82349 WP_001802667.1.82354 WP_001802667.1.82358 WP_001802667.1.82368 WP_001802667.1.82406 WP_001802667.1.8244 WP_001802667.1.82441 WP_001802667.1.82447 WP_001802667.1.82455 WP_001802667.1.82458 WP_001802667.1.8246 WP_001802667.1.82467 WP_001802667.1.82468 WP_001802667.1.82472 WP_001802667.1.82525 WP_001802667.1.82535 WP_001802667.1.82548 WP_001802667.1.82558 WP_001802667.1.8261 WP_001802667.1.82612 WP_001802667.1.8265 WP_001802667.1.8266 WP_001802667.1.82664 WP_001802667.1.82665 WP_001802667.1.82678 WP_001802667.1.82709 WP_001802667.1.82724 WP_001802667.1.82760 WP_001802667.1.82762 WP_001802667.1.82768 WP_001802667.1.82775 WP_001802667.1.82796 WP_001802667.1.8280 WP_001802667.1.82802 WP_001802667.1.82824 WP_001802667.1.82829 WP_001802667.1.82835 WP_001802667.1.82855 WP_001802667.1.82862 WP_001802667.1.8288 WP_001802667.1.8289 WP_001802667.1.82916 WP_001802667.1.82930 WP_001802667.1.82931 WP_001802667.1.82941 WP_001802667.1.82976 WP_001802667.1.82980 WP_001802667.1.82984 WP_001802667.1.82997 WP_001802667.1.82999 WP_001802667.1.83011 WP_001802667.1.83013 WP_001802667.1.8302 WP_001802667.1.83021 WP_001802667.1.83046 WP_001802667.1.83050 WP_001802667.1.83053 WP_001802667.1.83054 WP_001802667.1.83066 WP_001802667.1.83086 WP_001802667.1.83088 WP_001802667.1.8310 WP_001802667.1.83103 WP_001802667.1.83153 WP_001802667.1.8318 WP_001802667.1.83185 WP_001802667.1.8319 WP_001802667.1.83193 WP_001802667.1.83203 WP_001802667.1.83234 WP_001802667.1.83243 WP_001802667.1.83250 WP_001802667.1.8328 WP_001802667.1.83291 WP_001802667.1.83314 WP_001802667.1.83316 WP_001802667.1.83352 WP_001802667.1.83359 WP_001802667.1.83372 WP_001802667.1.83405 WP_001802667.1.83416 WP_001802667.1.83417 WP_001802667.1.83418 WP_001802667.1.8346 WP_001802667.1.83467 WP_001802667.1.83468 WP_001802667.1.83472 WP_001802667.1.83475 WP_001802667.1.83476 WP_001802667.1.83479 WP_001802667.1.83484 WP_001802667.1.83508 WP_001802667.1.83517 WP_001802667.1.83520 WP_001802667.1.83553 WP_001802667.1.83592 WP_001802667.1.83593 WP_001802667.1.83597 WP_001802667.1.83624 WP_001802667.1.83626 WP_001802667.1.83645 WP_001802667.1.83646 WP_001802667.1.83652 WP_001802667.1.83653 WP_001802667.1.8366 WP_001802667.1.83674 WP_001802667.1.83676 WP_001802667.1.83714 WP_001802667.1.83720 WP_001802667.1.83728 WP_001802667.1.83750 WP_001802667.1.83756 WP_001802667.1.83758 WP_001802667.1.83763 WP_001802667.1.83769 WP_001802667.1.83770 WP_001802667.1.83775 WP_001802667.1.83778 WP_001802667.1.83788 WP_001802667.1.83792 WP_001802667.1.83797 WP_001802667.1.83804 WP_001802667.1.83816 WP_001802667.1.83825 WP_001802667.1.8383 WP_001802667.1.83837 WP_001802667.1.83844 WP_001802667.1.83852 WP_001802667.1.83864 WP_001802667.1.83865 WP_001802667.1.83868 WP_001802667.1.83881 WP_001802667.1.83886 WP_001802667.1.83902 WP_001802667.1.83905 WP_001802667.1.83912 WP_001802667.1.83917 WP_001802667.1.83919 WP_001802667.1.83925 WP_001802667.1.83928 WP_001802667.1.83935 WP_001802667.1.83955 WP_001802667.1.83984 WP_001802667.1.83989 WP_001802667.1.84010 WP_001802667.1.84025 WP_001802667.1.84041 WP_001802667.1.84049 WP_001802667.1.84054 WP_001802667.1.84064 WP_001802667.1.84067 WP_001802667.1.84068 WP_001802667.1.84118 WP_001802667.1.84129 WP_001802667.1.84144 WP_001802667.1.84161 WP_001802667.1.84163 WP_001802667.1.84188 WP_001802667.1.84194 WP_001802667.1.84275 WP_001802667.1.84284 WP_001802667.1.84293 WP_001802667.1.8432 WP_001802667.1.84322 WP_001802667.1.84342 WP_001802667.1.84414 WP_001802667.1.84415 WP_001802667.1.84416 WP_001802667.1.84418 WP_001802667.1.84442 WP_001802667.1.84445 WP_001802667.1.84451 WP_001802667.1.84508 WP_001802667.1.84509 WP_001802667.1.84555 WP_001802667.1.84563 WP_001802667.1.84570 WP_001802667.1.84578 WP_001802667.1.84590 WP_001802667.1.84596 WP_001802667.1.84602 WP_001802667.1.84608 WP_001802667.1.84612 WP_001802667.1.8462 WP_001802667.1.84625 WP_001802667.1.84630 WP_001802667.1.84638 WP_001802667.1.84648 WP_001802667.1.84651 WP_001802667.1.84652 WP_001802667.1.84662 WP_001802667.1.84673 WP_001802667.1.84679 WP_001802667.1.8468 WP_001802667.1.84682 WP_001802667.1.84696 WP_001802667.1.84700 WP_001802667.1.84714 WP_001802667.1.84736 WP_001802667.1.8475 WP_001802667.1.84752 WP_001802667.1.84757 WP_001802667.1.84761 WP_001802667.1.84770 WP_001802667.1.84815 WP_001802667.1.84826 WP_001802667.1.84844 WP_001802667.1.84847 WP_001802667.1.84854 WP_001802667.1.84874 WP_001802667.1.84889 WP_001802667.1.84903 WP_001802667.1.84907 WP_001802667.1.84922 WP_001802667.1.84924 WP_001802667.1.8493 WP_001802667.1.84943 WP_001802667.1.84951 WP_001802667.1.8496 WP_001802667.1.84975 WP_001802667.1.84978 WP_001802667.1.85017 WP_001802667.1.85022 WP_001802667.1.85026 WP_001802667.1.85045 WP_001802667.1.85047 WP_001802667.1.85056 WP_001802667.1.85070 WP_001802667.1.85081 WP_001802667.1.85083 WP_001802667.1.85099 WP_001802667.1.851 WP_001802667.1.85113 WP_001802667.1.85118 WP_001802667.1.85135 WP_001802667.1.85144 WP_001802667.1.85151 WP_001802667.1.85160 WP_001802667.1.85173 WP_001802667.1.85198 WP_001802667.1.85224 WP_001802667.1.85226 WP_001802667.1.85229 WP_001802667.1.85231 WP_001802667.1.85235 WP_001802667.1.85238 WP_001802667.1.85265 WP_001802667.1.85289 WP_001802667.1.85292 WP_001802667.1.85294 WP_001802667.1.85297 WP_001802667.1.85302 WP_001802667.1.85331 WP_001802667.1.85351 WP_001802667.1.85354 WP_001802667.1.85374 WP_001802667.1.85375 WP_001802667.1.85376 WP_001802667.1.85383 WP_001802667.1.85395 WP_001802667.1.85401 WP_001802667.1.85404 WP_001802667.1.85409 WP_001802667.1.85425 WP_001802667.1.85440 WP_001802667.1.85441 WP_001802667.1.85445 WP_001802667.1.85455 WP_001802667.1.85462 WP_001802667.1.85471 WP_001802667.1.85474 WP_001802667.1.85485 WP_001802667.1.85506 WP_001802667.1.8551 WP_001802667.1.85515 WP_001802667.1.85519 WP_001802667.1.85542 WP_001802667.1.85547 WP_001802667.1.85549 WP_001802667.1.85555 WP_001802667.1.85562 WP_001802667.1.85585 WP_001802667.1.85586 WP_001802667.1.85596 WP_001802667.1.85607 WP_001802667.1.85611 WP_001802667.1.85634 WP_001802667.1.85649 WP_001802667.1.85678 WP_001802667.1.85705 WP_001802667.1.8572 WP_001802667.1.85730 WP_001802667.1.85732 WP_001802667.1.85758 WP_001802667.1.85795 WP_001802667.1.85796 WP_001802667.1.85809 WP_001802667.1.85816 WP_001802667.1.85825 WP_001802667.1.85834 WP_001802667.1.85844 WP_001802667.1.85858 WP_001802667.1.85906 WP_001802667.1.85924 WP_001802667.1.85927 WP_001802667.1.85950 WP_001802667.1.85971 WP_001802667.1.85980 WP_001802667.1.85989 WP_001802667.1.85993 WP_001802667.1.86018 WP_001802667.1.86036 WP_001802667.1.86042 WP_001802667.1.86072 WP_001802667.1.86086 WP_001802667.1.8609 WP_001802667.1.86101 WP_001802667.1.86106 WP_001802667.1.86123 WP_001802667.1.86136 WP_001802667.1.86144 WP_001802667.1.86153 WP_001802667.1.86154 WP_001802667.1.86158 WP_001802667.1.8617 WP_001802667.1.86178 WP_001802667.1.86188 WP_001802667.1.86197 WP_001802667.1.862 WP_001802667.1.86207 WP_001802667.1.86209 WP_001802667.1.86241 WP_001802667.1.86248 WP_001802667.1.86256 WP_001802667.1.8627 WP_001802667.1.86270 WP_001802667.1.86281 WP_001802667.1.86304 WP_001802667.1.86315 WP_001802667.1.86331 WP_001802667.1.86344 WP_001802667.1.8636 WP_001802667.1.86363 WP_001802667.1.86367 WP_001802667.1.86378 WP_001802667.1.86390 WP_001802667.1.8641 WP_001802667.1.8643 WP_001802667.1.86439 WP_001802667.1.86455 WP_001802667.1.86473 WP_001802667.1.86482 WP_001802667.1.86505 WP_001802667.1.86523 WP_001802667.1.86531 WP_001802667.1.86542 WP_001802667.1.86606 WP_001802667.1.86628 WP_001802667.1.86629 WP_001802667.1.8663 WP_001802667.1.86664 WP_001802667.1.86704 WP_001802667.1.86706 WP_001802667.1.86745 WP_001802667.1.86754 WP_001802667.1.86779 WP_001802667.1.86792 WP_001802667.1.86793 WP_001802667.1.86795 WP_001802667.1.8681 WP_001802667.1.86838 WP_001802667.1.86881 WP_001802667.1.8690 WP_001802667.1.86910 WP_001802667.1.86911 WP_001802667.1.86916 WP_001802667.1.86940 WP_001802667.1.86942 WP_001802667.1.86955 WP_001802667.1.86961 WP_001802667.1.86968 WP_001802667.1.86977 WP_001802667.1.8699 WP_001802667.1.86999 WP_001802667.1.87021 WP_001802667.1.87022 WP_001802667.1.87042 WP_001802667.1.87057 WP_001802667.1.87072 WP_001802667.1.87088 WP_001802667.1.87090 WP_001802667.1.87096 WP_001802667.1.87097 WP_001802667.1.87100 WP_001802667.1.87110 WP_001802667.1.87119 WP_001802667.1.8712 WP_001802667.1.87122 WP_001802667.1.87133 WP_001802667.1.87137 WP_001802667.1.87141 WP_001802667.1.87168 WP_001802667.1.87175 WP_001802667.1.87190 WP_001802667.1.87194 WP_001802667.1.8720 WP_001802667.1.87204 WP_001802667.1.87221 WP_001802667.1.87250 WP_001802667.1.87260 WP_001802667.1.87261 WP_001802667.1.87263 WP_001802667.1.87272 WP_001802667.1.87285 WP_001802667.1.87290 WP_001802667.1.87296 WP_001802667.1.8731 WP_001802667.1.87363 WP_001802667.1.87372 WP_001802667.1.87378 WP_001802667.1.87388 WP_001802667.1.87391 WP_001802667.1.87396 WP_001802667.1.87397 WP_001802667.1.87434 WP_001802667.1.87457 WP_001802667.1.87461 WP_001802667.1.87466 WP_001802667.1.87475 WP_001802667.1.87486 WP_001802667.1.87497 WP_001802667.1.87498 WP_001802667.1.875 WP_001802667.1.87502 WP_001802667.1.87508 WP_001802667.1.87511 WP_001802667.1.87515 WP_001802667.1.8753 WP_001802667.1.87534 WP_001802667.1.87541 WP_001802667.1.87543 WP_001802667.1.8757 WP_001802667.1.87579 WP_001802667.1.87593 WP_001802667.1.87595 WP_001802667.1.87601 WP_001802667.1.87623 WP_001802667.1.87636 WP_001802667.1.8764 WP_001802667.1.87647 WP_001802667.1.87682 WP_001802667.1.8770 WP_001802667.1.87703 WP_001802667.1.87710 WP_001802667.1.87718 WP_001802667.1.87734 WP_001802667.1.87740 WP_001802667.1.87745 WP_001802667.1.87748 WP_001802667.1.87764 WP_001802667.1.87782 WP_001802667.1.8779 WP_001802667.1.87802 WP_001802667.1.87808 WP_001802667.1.87828 WP_001802667.1.87841 WP_001802667.1.87843 WP_001802667.1.87854 WP_001802667.1.87865 WP_001802667.1.87879 WP_001802667.1.8791 WP_001802667.1.87912 WP_001802667.1.87937 WP_001802667.1.87943 WP_001802667.1.87948 WP_001802667.1.87963 WP_001802667.1.87964 WP_001802667.1.87967 WP_001802667.1.87972 WP_001802667.1.87985 WP_001802667.1.87995 WP_001802667.1.88013 WP_001802667.1.88032 WP_001802667.1.88061 WP_001802667.1.88101 WP_001802667.1.88114 WP_001802667.1.88150 WP_001802667.1.88166 WP_001802667.1.88169 WP_001802667.1.8820 WP_001802667.1.88240 WP_001802667.1.88270 WP_001802667.1.88279 WP_001802667.1.88309 WP_001802667.1.88311 WP_001802667.1.88317 WP_001802667.1.88319 WP_001802667.1.88328 WP_001802667.1.88339 WP_001802667.1.88348 WP_001802667.1.88351 WP_001802667.1.88367 WP_001802667.1.88371 WP_001802667.1.88373 WP_001802667.1.88375 WP_001802667.1.88380 WP_001802667.1.88395 WP_001802667.1.88418 WP_001802667.1.88430 WP_001802667.1.88440 WP_001802667.1.88445 WP_001802667.1.88449 WP_001802667.1.88455 WP_001802667.1.8847 WP_001802667.1.88471 WP_001802667.1.88473 WP_001802667.1.88478 WP_001802667.1.88480 WP_001802667.1.88490 WP_001802667.1.88498 WP_001802667.1.88504 WP_001802667.1.88518 WP_001802667.1.88536 WP_001802667.1.88555 WP_001802667.1.88558 WP_001802667.1.88560 WP_001802667.1.88563 WP_001802667.1.8857 WP_001802667.1.88572 WP_001802667.1.88580 WP_001802667.1.88583 WP_001802667.1.88585 WP_001802667.1.8859 WP_001802667.1.88599 WP_001802667.1.88600 WP_001802667.1.88614 WP_001802667.1.88623 WP_001802667.1.88636 WP_001802667.1.88638 WP_001802667.1.88642 WP_001802667.1.88671 WP_001802667.1.88694 WP_001802667.1.88696 WP_001802667.1.8872 WP_001802667.1.88738 WP_001802667.1.88739 WP_001802667.1.88753 WP_001802667.1.88761 WP_001802667.1.8877 WP_001802667.1.88781 WP_001802667.1.88805 WP_001802667.1.88827 WP_001802667.1.88843 WP_001802667.1.88856 WP_001802667.1.88859 WP_001802667.1.8886 WP_001802667.1.88861 WP_001802667.1.88874 WP_001802667.1.88878 WP_001802667.1.8888 WP_001802667.1.88897 WP_001802667.1.88912 WP_001802667.1.88922 WP_001802667.1.88934 WP_001802667.1.88954 WP_001802667.1.88959 WP_001802667.1.88960 WP_001802667.1.88962 WP_001802667.1.88987 WP_001802667.1.8899 WP_001802667.1.8900 WP_001802667.1.89012 WP_001802667.1.89024 WP_001802667.1.89027 WP_001802667.1.89036 WP_001802667.1.8904 WP_001802667.1.89070 WP_001802667.1.89086 WP_001802667.1.89103 WP_001802667.1.89108 WP_001802667.1.89125 WP_001802667.1.8913 WP_001802667.1.89133 WP_001802667.1.89139 WP_001802667.1.89164 WP_001802667.1.89173 WP_001802667.1.8918 WP_001802667.1.89181 WP_001802667.1.89184 WP_001802667.1.89194 WP_001802667.1.89195 WP_001802667.1.89204 WP_001802667.1.89216 WP_001802667.1.89229 WP_001802667.1.89235 WP_001802667.1.89237 WP_001802667.1.8924 WP_001802667.1.89258 WP_001802667.1.89262 WP_001802667.1.89284 WP_001802667.1.89290 WP_001802667.1.89347 WP_001802667.1.89348 WP_001802667.1.89350 WP_001802667.1.89372 WP_001802667.1.89390 WP_001802667.1.89404 WP_001802667.1.89414 WP_001802667.1.89433 WP_001802667.1.89439 WP_001802667.1.89476 WP_001802667.1.8950 WP_001802667.1.89516 WP_001802667.1.8953 WP_001802667.1.89537 WP_001802667.1.89544 WP_001802667.1.89545 WP_001802667.1.89556 WP_001802667.1.89557 WP_001802667.1.89559 WP_001802667.1.89603 WP_001802667.1.89628 WP_001802667.1.89651 WP_001802667.1.89655 WP_001802667.1.89672 WP_001802667.1.89678 WP_001802667.1.89686 WP_001802667.1.897 WP_001802667.1.89715 WP_001802667.1.89726 WP_001802667.1.89730 WP_001802667.1.89738 WP_001802667.1.89754 WP_001802667.1.89779 WP_001802667.1.89794 WP_001802667.1.89799 WP_001802667.1.898 WP_001802667.1.89857 WP_001802667.1.8986 WP_001802667.1.89860 WP_001802667.1.89863 WP_001802667.1.89874 WP_001802667.1.89883 WP_001802667.1.8990 WP_001802667.1.89908 WP_001802667.1.89924 WP_001802667.1.89933 WP_001802667.1.89935 WP_001802667.1.89949 WP_001802667.1.89950 WP_001802667.1.89960 WP_001802667.1.90005 WP_001802667.1.90018 WP_001802667.1.90038 WP_001802667.1.90046 WP_001802667.1.90055 WP_001802667.1.90069 WP_001802667.1.90091 WP_001802667.1.90095 WP_001802667.1.90112 WP_001802667.1.90131 WP_001802667.1.90145 WP_001802667.1.90148 WP_001802667.1.90161 WP_001802667.1.90173 WP_001802667.1.90174 WP_001802667.1.90180 WP_001802667.1.90215 WP_001802667.1.90217 WP_001802667.1.9022 WP_001802667.1.90232 WP_001802667.1.90239 WP_001802667.1.90243 WP_001802667.1.90244 WP_001802667.1.90246 WP_001802667.1.90250 WP_001802667.1.90253 WP_001802667.1.90269 WP_001802667.1.90276 WP_001802667.1.9030 WP_001802667.1.90307 WP_001802667.1.90331 WP_001802667.1.90345 WP_001802667.1.90367 WP_001802667.1.90370 WP_001802667.1.90386 WP_001802667.1.90432 WP_001802667.1.90447 WP_001802667.1.90454 WP_001802667.1.90473 WP_001802667.1.90475 WP_001802667.1.90488 WP_001802667.1.90506 WP_001802667.1.90514 WP_001802667.1.90517 WP_001802667.1.90533 WP_001802667.1.90544 WP_001802667.1.90548 WP_001802667.1.9055 WP_001802667.1.90554 WP_001802667.1.90562 WP_001802667.1.90604 WP_001802667.1.90647 WP_001802667.1.90660 WP_001802667.1.90661 WP_001802667.1.90683 WP_001802667.1.90698 WP_001802667.1.9071 WP_001802667.1.90717 WP_001802667.1.90726 WP_001802667.1.90728 WP_001802667.1.90738 WP_001802667.1.9074 WP_001802667.1.90740 WP_001802667.1.90745 WP_001802667.1.90757 WP_001802667.1.9076 WP_001802667.1.90777 WP_001802667.1.90801 WP_001802667.1.90804 WP_001802667.1.90820 WP_001802667.1.90861 WP_001802667.1.90875 WP_001802667.1.90887 WP_001802667.1.90896 WP_001802667.1.90903 WP_001802667.1.90923 WP_001802667.1.90928 WP_001802667.1.90994 WP_001802667.1.9100 WP_001802667.1.91005 WP_001802667.1.91011 WP_001802667.1.91019 WP_001802667.1.91054 WP_001802667.1.91089 WP_001802667.1.91124 WP_001802667.1.91126 WP_001802667.1.9114 WP_001802667.1.91150 WP_001802667.1.91158 WP_001802667.1.91177 WP_001802667.1.91184 WP_001802667.1.912 WP_001802667.1.9122 WP_001802667.1.91233 WP_001802667.1.91246 WP_001802667.1.91258 WP_001802667.1.9127 WP_001802667.1.91279 WP_001802667.1.91280 WP_001802667.1.91287 WP_001802667.1.91297 WP_001802667.1.9130 WP_001802667.1.91300 WP_001802667.1.91310 WP_001802667.1.91316 WP_001802667.1.91332 WP_001802667.1.91346 WP_001802667.1.91357 WP_001802667.1.91364 WP_001802667.1.91371 WP_001802667.1.91380 WP_001802667.1.91382 WP_001802667.1.9140 WP_001802667.1.91420 WP_001802667.1.91427 WP_001802667.1.91447 WP_001802667.1.91465 WP_001802667.1.91486 WP_001802667.1.91487 WP_001802667.1.91500 WP_001802667.1.91501 WP_001802667.1.91525 WP_001802667.1.9153 WP_001802667.1.91530 WP_001802667.1.91542 WP_001802667.1.91547 WP_001802667.1.9155 WP_001802667.1.91559 WP_001802667.1.91573 WP_001802667.1.91581 WP_001802667.1.91586 WP_001802667.1.91587 WP_001802667.1.91591 WP_001802667.1.91611 WP_001802667.1.91624 WP_001802667.1.91629 WP_001802667.1.91634 WP_001802667.1.91635 WP_001802667.1.91639 WP_001802667.1.91660 WP_001802667.1.91670 WP_001802667.1.917 WP_001802667.1.91704 WP_001802667.1.91745 WP_001802667.1.91746 WP_001802667.1.91749 WP_001802667.1.91771 WP_001802667.1.91781 WP_001802667.1.91791 WP_001802667.1.91800 WP_001802667.1.91816 WP_001802667.1.91829 WP_001802667.1.91848 WP_001802667.1.91895 WP_001802667.1.91909 WP_001802667.1.91911 WP_001802667.1.91918 WP_001802667.1.91919 WP_001802667.1.91928 WP_001802667.1.91950 WP_001802667.1.91955 WP_001802667.1.91969 WP_001802667.1.92 WP_001802667.1.92055 WP_001802667.1.92057 WP_001802667.1.92080 WP_001802667.1.92104 WP_001802667.1.92110 WP_001802667.1.92115 WP_001802667.1.92125 WP_001802667.1.92133 WP_001802667.1.92140 WP_001802667.1.92143 WP_001802667.1.92147 WP_001802667.1.92158 WP_001802667.1.92164 WP_001802667.1.92169 WP_001802667.1.92173 WP_001802667.1.92185 WP_001802667.1.92186 WP_001802667.1.92196 WP_001802667.1.92212 WP_001802667.1.92218 WP_001802667.1.92227 WP_001802667.1.92228 WP_001802667.1.9224 WP_001802667.1.92244 WP_001802667.1.92249 WP_001802667.1.92253 WP_001802667.1.92254 WP_001802667.1.92259 WP_001802667.1.92278 WP_001802667.1.92303 WP_001802667.1.92324 WP_001802667.1.9234 WP_001802667.1.92340 WP_001802667.1.9237 WP_001802667.1.9239 WP_001802667.1.92391 WP_001802667.1.92405 WP_001802667.1.92415 WP_001802667.1.92424 WP_001802667.1.92425 WP_001802667.1.92436 WP_001802667.1.92442 WP_001802667.1.9247 WP_001802667.1.92479 WP_001802667.1.92488 WP_001802667.1.92497 WP_001802667.1.92500 WP_001802667.1.92512 WP_001802667.1.92520 WP_001802667.1.92534 WP_001802667.1.92544 WP_001802667.1.92546 WP_001802667.1.92560 WP_001802667.1.92565 WP_001802667.1.92602 WP_001802667.1.92607 WP_001802667.1.92667 WP_001802667.1.92674 WP_001802667.1.92679 WP_001802667.1.92688 WP_001802667.1.92691 WP_001802667.1.92718 WP_001802667.1.92723 WP_001802667.1.92726 WP_001802667.1.92735 WP_001802667.1.92741 WP_001802667.1.92765 WP_001802667.1.92772 WP_001802667.1.92773 WP_001802667.1.92778 WP_001802667.1.92789 WP_001802667.1.92795 WP_001802667.1.92805 WP_001802667.1.92840 WP_001802667.1.92848 WP_001802667.1.92849 WP_001802667.1.9286 WP_001802667.1.92862 WP_001802667.1.92864 WP_001802667.1.92918 WP_001802667.1.9293 WP_001802667.1.92950 WP_001802667.1.9296 WP_001802667.1.92960 WP_001802667.1.92965 WP_001802667.1.9298 WP_001802667.1.92997 WP_001802667.1.93010 WP_001802667.1.93041 WP_001802667.1.93047 WP_001802667.1.9305 WP_001802667.1.93068 WP_001802667.1.93071 WP_001802667.1.93074 WP_001802667.1.93078 WP_001802667.1.93125 WP_001802667.1.93141 WP_001802667.1.93147 WP_001802667.1.93163 WP_001802667.1.93176 WP_001802667.1.93186 WP_001802667.1.93191 WP_001802667.1.93197 WP_001802667.1.93198 WP_001802667.1.93207 WP_001802667.1.93211 WP_001802667.1.93224 WP_001802667.1.93231 WP_001802667.1.93235 WP_001802667.1.93237 WP_001802667.1.93243 WP_001802667.1.93251 WP_001802667.1.93254 WP_001802667.1.93263 WP_001802667.1.93272 WP_001802667.1.9330 WP_001802667.1.93300 WP_001802667.1.93310 WP_001802667.1.93329 WP_001802667.1.93336 WP_001802667.1.93374 WP_001802667.1.93378 WP_001802667.1.93416 WP_001802667.1.93435 WP_001802667.1.93438 WP_001802667.1.93444 WP_001802667.1.9346 WP_001802667.1.93471 WP_001802667.1.93492 WP_001802667.1.93514 WP_001802667.1.9352 WP_001802667.1.93538 WP_001802667.1.9354 WP_001802667.1.93561 WP_001802667.1.93567 WP_001802667.1.93579 WP_001802667.1.9358 WP_001802667.1.93590 WP_001802667.1.93613 WP_001802667.1.93647 WP_001802667.1.93658 WP_001802667.1.93669 WP_001802667.1.93678 WP_001802667.1.93690 WP_001802667.1.93708 WP_001802667.1.93710 WP_001802667.1.93722 WP_001802667.1.93736 WP_001802667.1.93738 WP_001802667.1.93758 WP_001802667.1.93762 WP_001802667.1.93769 WP_001802667.1.93775 WP_001802667.1.93787 WP_001802667.1.93862 WP_001802667.1.9387 WP_001802667.1.93882 WP_001802667.1.93883 WP_001802667.1.93890 WP_001802667.1.93891 WP_001802667.1.9392 WP_001802667.1.93934 WP_001802667.1.93972 WP_001802667.1.93975 WP_001802667.1.93976 WP_001802667.1.9398 WP_001802667.1.93981 WP_001802667.1.94 WP_001802667.1.94009 WP_001802667.1.94016 WP_001802667.1.94053 WP_001802667.1.94060 WP_001802667.1.94074 WP_001802667.1.9408 WP_001802667.1.94080 WP_001802667.1.94082 WP_001802667.1.94087 WP_001802667.1.94093 WP_001802667.1.94096 WP_001802667.1.9411 WP_001802667.1.94114 WP_001802667.1.94119 WP_001802667.1.94122 WP_001802667.1.94123 WP_001802667.1.94130 WP_001802667.1.94165 WP_001802667.1.94172 WP_001802667.1.94209 WP_001802667.1.94229 WP_001802667.1.94242 WP_001802667.1.94245 WP_001802667.1.94248 WP_001802667.1.94268 WP_001802667.1.94287 WP_001802667.1.94293 WP_001802667.1.94294 WP_001802667.1.9430 WP_001802667.1.94319 WP_001802667.1.94320 WP_001802667.1.94324 WP_001802667.1.94325 WP_001802667.1.94335 WP_001802667.1.94337 WP_001802667.1.94340 WP_001802667.1.94341 WP_001802667.1.94345 WP_001802667.1.9435 WP_001802667.1.9437 WP_001802667.1.94374 WP_001802667.1.94375 WP_001802667.1.94376 WP_001802667.1.94389 WP_001802667.1.94407 WP_001802667.1.94409 WP_001802667.1.94414 WP_001802667.1.94423 WP_001802667.1.94505 WP_001802667.1.94530 WP_001802667.1.94536 WP_001802667.1.94549 WP_001802667.1.94550 WP_001802667.1.94576 WP_001802667.1.94625 WP_001802667.1.94636 WP_001802667.1.9464 WP_001802667.1.94641 WP_001802667.1.94684 WP_001802667.1.94688 WP_001802667.1.947 WP_001802667.1.94719 WP_001802667.1.94733 WP_001802667.1.94741 WP_001802667.1.94789 WP_001802667.1.94797 WP_001802667.1.94825 WP_001802667.1.94844 WP_001802667.1.94845 WP_001802667.1.9485 WP_001802667.1.94857 WP_001802667.1.94866 WP_001802667.1.94941 WP_001802667.1.9495 WP_001802667.1.94958 WP_001802667.1.94969 WP_001802667.1.94980 WP_001802667.1.94989 WP_001802667.1.94992 WP_001802667.1.94999 WP_001802667.1.95002 WP_001802667.1.95008 WP_001802667.1.95014 WP_001802667.1.95023 WP_001802667.1.95029 WP_001802667.1.95033 WP_001802667.1.95038 WP_001802667.1.95049 WP_001802667.1.95075 WP_001802667.1.95077 WP_001802667.1.95090 WP_001802667.1.9510 WP_001802667.1.95120 WP_001802667.1.95154 WP_001802667.1.95156 WP_001802667.1.95174 WP_001802667.1.95193 WP_001802667.1.95210 WP_001802667.1.95263 WP_001802667.1.95281 WP_001802667.1.95294 WP_001802667.1.95304 WP_001802667.1.95307 WP_001802667.1.95318 WP_001802667.1.95327 WP_001802667.1.95342 WP_001802667.1.95361 WP_001802667.1.95372 WP_001802667.1.95386 WP_001802667.1.95409 WP_001802667.1.95415 WP_001802667.1.9544 WP_001802667.1.95442 WP_001802667.1.95452 WP_001802667.1.95476 WP_001802667.1.95494 WP_001802667.1.95495 WP_001802667.1.95500 WP_001802667.1.95505 WP_001802667.1.95512 WP_001802667.1.95519 WP_001802667.1.95522 WP_001802667.1.95535 WP_001802667.1.95537 WP_001802667.1.95545 WP_001802667.1.95550 WP_001802667.1.95552 WP_001802667.1.95560 WP_001802667.1.95581 WP_001802667.1.95603 WP_001802667.1.9563 WP_001802667.1.95631 WP_001802667.1.95639 WP_001802667.1.95640 WP_001802667.1.95681 WP_001802667.1.95683 WP_001802667.1.95699 WP_001802667.1.95704 WP_001802667.1.95713 WP_001802667.1.95714 WP_001802667.1.95737 WP_001802667.1.95760 WP_001802667.1.95780 WP_001802667.1.95781 WP_001802667.1.95804 WP_001802667.1.95806 WP_001802667.1.95832 WP_001802667.1.95877 WP_001802667.1.95885 WP_001802667.1.959 WP_001802667.1.95914 WP_001802667.1.95918 WP_001802667.1.95947 WP_001802667.1.95954 WP_001802667.1.95962 WP_001802667.1.95983 WP_001802667.1.95986 WP_001802667.1.95997 WP_001802667.1.96014 WP_001802667.1.96022 WP_001802667.1.96030 WP_001802667.1.96056 WP_001802667.1.96057 WP_001802667.1.96067 WP_001802667.1.96075 WP_001802667.1.96105 WP_001802667.1.96133 WP_001802667.1.96135 WP_001802667.1.96148 WP_001802667.1.96160 WP_001802667.1.96163 WP_001802667.1.9617 WP_001802667.1.96200 WP_001802667.1.96209 WP_001802667.1.96218 WP_001802667.1.96221 WP_001802667.1.96228 WP_001802667.1.96255 WP_001802667.1.96261 WP_001802667.1.96271 WP_001802667.1.96280 WP_001802667.1.96283 WP_001802667.1.96297 WP_001802667.1.96301 WP_001802667.1.96305 WP_001802667.1.96314 WP_001802667.1.96316 WP_001802667.1.96322 WP_001802667.1.96334 WP_001802667.1.96362 WP_001802667.1.96364 WP_001802667.1.96368 WP_001802667.1.96412 WP_001802667.1.96424 WP_001802667.1.96433 WP_001802667.1.96468 WP_001802667.1.96472 WP_001802667.1.96477 WP_001802667.1.96489 WP_001802667.1.96495 WP_001802667.1.9650 WP_001802667.1.96509 WP_001802667.1.96535 WP_001802667.1.96538 WP_001802667.1.96550 WP_001802667.1.96554 WP_001802667.1.96566 WP_001802667.1.96568 WP_001802667.1.96577 WP_001802667.1.96578 WP_001802667.1.96591 WP_001802667.1.96603 WP_001802667.1.96613 WP_001802667.1.96628 WP_001802667.1.96638 WP_001802667.1.96646 WP_001802667.1.96654 WP_001802667.1.96663 WP_001802667.1.96678 WP_001802667.1.96682 WP_001802667.1.96688 WP_001802667.1.96699 WP_001802667.1.96705 WP_001802667.1.96718 WP_001802667.1.96727 WP_001802667.1.9675 WP_001802667.1.96770 WP_001802667.1.96780 WP_001802667.1.96804 WP_001802667.1.96836 WP_001802667.1.9684 WP_001802667.1.96854 WP_001802667.1.96855 WP_001802667.1.96856 WP_001802667.1.96859 WP_001802667.1.96866 WP_001802667.1.96882 WP_001802667.1.96892 WP_001802667.1.96895 WP_001802667.1.96918 WP_001802667.1.96922 WP_001802667.1.96928 WP_001802667.1.9695 WP_001802667.1.96956 WP_001802667.1.96965 WP_001802667.1.96969 WP_001802667.1.96970 WP_001802667.1.96976 WP_001802667.1.96985 WP_001802667.1.96997 WP_001802667.1.97000 WP_001802667.1.97001 WP_001802667.1.97007 WP_001802667.1.97014 WP_001802667.1.97017 WP_001802667.1.97019 WP_001802667.1.97029 WP_001802667.1.97033 WP_001802667.1.97034 WP_001802667.1.97072 WP_001802667.1.97077 WP_001802667.1.97117 WP_001802667.1.97138 WP_001802667.1.97139 WP_001802667.1.97141 WP_001802667.1.97146 WP_001802667.1.97151 WP_001802667.1.97161 WP_001802667.1.97164 WP_001802667.1.97191 WP_001802667.1.97205 WP_001802667.1.97206 WP_001802667.1.97228 WP_001802667.1.97230 WP_001802667.1.97241 WP_001802667.1.97256 WP_001802667.1.97267 WP_001802667.1.97276 WP_001802667.1.97293 WP_001802667.1.97295 WP_001802667.1.97302 WP_001802667.1.97311 WP_001802667.1.97312 WP_001802667.1.97336 WP_001802667.1.97348 WP_001802667.1.97352 WP_001802667.1.97355 WP_001802667.1.97367 WP_001802667.1.97392 WP_001802667.1.97399 WP_001802667.1.97409 WP_001802667.1.97411 WP_001802667.1.97427 WP_001802667.1.9743 WP_001802667.1.97444 WP_001802667.1.97450 WP_001802667.1.97456 WP_001802667.1.97460 WP_001802667.1.97466 WP_001802667.1.97468 WP_001802667.1.9748 WP_001802667.1.97484 WP_001802667.1.97494 WP_001802667.1.97530 WP_001802667.1.97531 WP_001802667.1.97536 WP_001802667.1.97537 WP_001802667.1.97574 WP_001802667.1.97575 WP_001802667.1.97576 WP_001802667.1.9758 WP_001802667.1.97585 WP_001802667.1.97590 WP_001802667.1.97627 WP_001802667.1.97641 WP_001802667.1.97664 WP_001802667.1.97687 WP_001802667.1.97688 WP_001802667.1.97696 WP_001802667.1.97699 WP_001802667.1.97706 WP_001802667.1.97717 WP_001802667.1.97729 WP_001802667.1.97731 WP_001802667.1.97739 WP_001802667.1.97742 WP_001802667.1.97744 WP_001802667.1.97746 WP_001802667.1.97758 WP_001802667.1.97762 WP_001802667.1.97763 WP_001802667.1.97776 WP_001802667.1.97786 WP_001802667.1.97827 WP_001802667.1.97835 WP_001802667.1.9788 WP_001802667.1.9789 WP_001802667.1.97898 WP_001802667.1.97899 WP_001802667.1.97935 WP_001802667.1.97953 WP_001802667.1.97955 WP_001802667.1.97967 WP_001802667.1.97974 WP_001802667.1.97997 WP_001802667.1.97999 WP_001802667.1.98008 WP_001802667.1.98011 WP_001802667.1.98033 WP_001802667.1.98051 WP_001802667.1.98054 WP_001802667.1.98058 WP_001802667.1.98073 WP_001802667.1.98077 WP_001802667.1.98131 WP_001802667.1.98161 WP_001802667.1.98174 WP_001802667.1.98179 WP_001802667.1.98191 WP_001802667.1.98195 WP_001802667.1.98233 WP_001802667.1.98242 WP_001802667.1.98248 WP_001802667.1.98249 WP_001802667.1.98281 WP_001802667.1.98295 WP_001802667.1.98307 WP_001802667.1.98322 WP_001802667.1.98328 WP_001802667.1.98352 WP_001802667.1.98353 WP_001802667.1.98359 WP_001802667.1.98361 WP_001802667.1.98366 WP_001802667.1.98372 WP_001802667.1.98379 WP_001802667.1.98387 WP_001802667.1.98394 WP_001802667.1.98409 WP_001802667.1.98411 WP_001802667.1.98415 WP_001802667.1.98419 WP_001802667.1.98425 WP_001802667.1.98456 WP_001802667.1.98501 WP_001802667.1.98506 WP_001802667.1.98510 WP_001802667.1.98512 WP_001802667.1.98533 WP_001802667.1.98548 WP_001802667.1.98552 WP_001802667.1.98559 WP_001802667.1.98585 WP_001802667.1.98586 WP_001802667.1.986 WP_001802667.1.98609 WP_001802667.1.98655 WP_001802667.1.98659 WP_001802667.1.98667 WP_001802667.1.98703 WP_001802667.1.98706 WP_001802667.1.98710 WP_001802667.1.9872 WP_001802667.1.98723 WP_001802667.1.98730 WP_001802667.1.98734 WP_001802667.1.98741 WP_001802667.1.98750 WP_001802667.1.98767 WP_001802667.1.98786 WP_001802667.1.98797 WP_001802667.1.98805 WP_001802667.1.98807 WP_001802667.1.98821 WP_001802667.1.98825 WP_001802667.1.98837 WP_001802667.1.98842 WP_001802667.1.98865 WP_001802667.1.98874 WP_001802667.1.98880 WP_001802667.1.98883 WP_001802667.1.98894 WP_001802667.1.98912 WP_001802667.1.98924 WP_001802667.1.98967 WP_001802667.1.98978 WP_001802667.1.98981 WP_001802667.1.98985 WP_001802667.1.99009 WP_001802667.1.99025 WP_001802667.1.9903 WP_001802667.1.99081 WP_001802667.1.99090 WP_001802667.1.991 WP_001802667.1.9910 WP_001802667.1.9912 WP_001802667.1.99136 WP_001802667.1.99155 WP_001802667.1.99171 WP_001802667.1.99174 WP_001802667.1.99183 WP_001802667.1.99195 WP_001802667.1.99207 WP_001802667.1.99217 WP_001802667.1.99228 WP_001802667.1.99237 WP_001802667.1.99249 WP_001802667.1.99262 WP_001802667.1.99280 WP_001802667.1.99283 WP_001802667.1.99308 WP_001802667.1.99331 WP_001802667.1.99359 WP_001802667.1.9936 WP_001802667.1.99394 WP_001802667.1.99405 WP_001802667.1.99414 WP_001802667.1.99418 WP_001802667.1.99430 WP_001802667.1.99492 WP_001802667.1.99494 WP_001802667.1.99509 WP_001802667.1.99519 WP_001802667.1.99523 WP_001802667.1.99524 WP_001802667.1.99525 WP_001802667.1.99538 WP_001802667.1.99564 WP_001802667.1.99569 WP_001802667.1.9960 WP_001802667.1.99631 WP_001802667.1.99638 WP_001802667.1.9965 WP_001802667.1.99683 WP_001802667.1.99686 WP_001802667.1.99688 WP_001802667.1.99700 WP_001802667.1.99714 WP_001802667.1.9974 WP_001802667.1.99759 WP_001802667.1.99768 WP_001802667.1.99777 WP_001802667.1.99802 WP_001802667.1.99830 WP_001802667.1.99849 WP_001802667.1.9985 WP_001802667.1.99850 WP_001802667.1.99859 WP_001802667.1.99860 WP_001802667.1.99862 WP_001802667.1.9987 WP_001802667.1.99884 WP_001802667.1.99888 WP_001802667.1.99901 WP_001802667.1.99926 WP_001802667.1.99934 WP_001802667.1.99950 WP_001802667.1.99954 WP_001802667.1.99955 WP_001802667.1.99956 WP_001802667.1.99963 WP_001802667.1.99979 WP_001802667.1.99984 WP_001802667.1.99985 WP_001802667.1.99999 YP_500187.1.76163 451515.SAUSA300_1534 93061.SAOUHSC_01677 gi|88195383|ref|YP_500187.1| gi|384547807|ref|YP_005737060.1| gi|87160269|ref|YP_494229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]