SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 451516.USA300HOU_2322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  451516.USA300HOU_2322
Domain Number - Region: 115-189
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0141
Family D-glucarate dehydratase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 451516.USA300HOU_2322
Sequence length 410
Comment (Staphylococcus aureus USA300 TCH1516)
Sequence
MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGITAYVLLAAILG
SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
Download sequence
Identical sequences A0A0D6H383 A0A0E1AJ69 A0A0H2WWV3 A0A0H2XI61 A0A0H3KA61 A0A1E8XEJ6 A0A2K4E6P6 Q2FVS4
gi|87161971|ref|YP_494922.1| gi|151222453|ref|YP_001333275.1| gi|521213096|ref|YP_008169442.1| gi|161510534|ref|YP_001576193.1| gi|379015463|ref|YP_005291699.1| gi|57650883|ref|YP_187141.1| gi|88196259|ref|YP_501079.1| gi|384862983|ref|YP_005745703.1| gi|479330342|ref|YP_007869401.1| gi|384870893|ref|YP_005753607.1| WP_000548707.1.100013 WP_000548707.1.100049 WP_000548707.1.100057 WP_000548707.1.100067 WP_000548707.1.100072 WP_000548707.1.100088 WP_000548707.1.100090 WP_000548707.1.100094 WP_000548707.1.100154 WP_000548707.1.100180 WP_000548707.1.100189 WP_000548707.1.100298 WP_000548707.1.100307 WP_000548707.1.100352 WP_000548707.1.100391 WP_000548707.1.10041 WP_000548707.1.100618 WP_000548707.1.100631 WP_000548707.1.100647 WP_000548707.1.100761 WP_000548707.1.100768 WP_000548707.1.100834 WP_000548707.1.100903 WP_000548707.1.100920 WP_000548707.1.100963 WP_000548707.1.100981 WP_000548707.1.100987 WP_000548707.1.101017 WP_000548707.1.101084 WP_000548707.1.101177 WP_000548707.1.101240 WP_000548707.1.101266 WP_000548707.1.101327 WP_000548707.1.101375 WP_000548707.1.101393 WP_000548707.1.101490 WP_000548707.1.101505 WP_000548707.1.101566 WP_000548707.1.101570 WP_000548707.1.101615 WP_000548707.1.10166 WP_000548707.1.101725 WP_000548707.1.101757 WP_000548707.1.101788 WP_000548707.1.101950 WP_000548707.1.1022 WP_000548707.1.10232 WP_000548707.1.10397 WP_000548707.1.10486 WP_000548707.1.10503 WP_000548707.1.10542 WP_000548707.1.10543 WP_000548707.1.10565 WP_000548707.1.10614 WP_000548707.1.10679 WP_000548707.1.10707 WP_000548707.1.10726 WP_000548707.1.10742 WP_000548707.1.10950 WP_000548707.1.11129 WP_000548707.1.1120 WP_000548707.1.11287 WP_000548707.1.11294 WP_000548707.1.11348 WP_000548707.1.11353 WP_000548707.1.1136 WP_000548707.1.11377 WP_000548707.1.11407 WP_000548707.1.11488 WP_000548707.1.11492 WP_000548707.1.11525 WP_000548707.1.11558 WP_000548707.1.11592 WP_000548707.1.11692 WP_000548707.1.117 WP_000548707.1.11719 WP_000548707.1.11720 WP_000548707.1.11795 WP_000548707.1.11829 WP_000548707.1.12005 WP_000548707.1.1205 WP_000548707.1.12098 WP_000548707.1.12123 WP_000548707.1.12179 WP_000548707.1.12181 WP_000548707.1.12226 WP_000548707.1.12233 WP_000548707.1.12297 WP_000548707.1.12328 WP_000548707.1.12447 WP_000548707.1.12498 WP_000548707.1.12639 WP_000548707.1.12715 WP_000548707.1.12771 WP_000548707.1.12822 WP_000548707.1.12833 WP_000548707.1.12845 WP_000548707.1.12862 WP_000548707.1.12903 WP_000548707.1.12937 WP_000548707.1.12938 WP_000548707.1.13039 WP_000548707.1.13072 WP_000548707.1.13091 WP_000548707.1.13104 WP_000548707.1.13322 WP_000548707.1.1347 WP_000548707.1.13486 WP_000548707.1.13531 WP_000548707.1.1355 WP_000548707.1.13556 WP_000548707.1.13568 WP_000548707.1.13617 WP_000548707.1.13654 WP_000548707.1.13683 WP_000548707.1.13726 WP_000548707.1.1374 WP_000548707.1.13755 WP_000548707.1.13772 WP_000548707.1.13804 WP_000548707.1.13805 WP_000548707.1.13914 WP_000548707.1.13940 WP_000548707.1.13983 WP_000548707.1.14071 WP_000548707.1.14112 WP_000548707.1.14153 WP_000548707.1.14233 WP_000548707.1.1426 WP_000548707.1.14364 WP_000548707.1.14365 WP_000548707.1.14366 WP_000548707.1.14394 WP_000548707.1.14418 WP_000548707.1.14475 WP_000548707.1.147 WP_000548707.1.14790 WP_000548707.1.14809 WP_000548707.1.14869 WP_000548707.1.14888 WP_000548707.1.14902 WP_000548707.1.14987 WP_000548707.1.15000 WP_000548707.1.15091 WP_000548707.1.15228 WP_000548707.1.15255 WP_000548707.1.15263 WP_000548707.1.15278 WP_000548707.1.15329 WP_000548707.1.15399 WP_000548707.1.15409 WP_000548707.1.15438 WP_000548707.1.1545 WP_000548707.1.15489 WP_000548707.1.15505 WP_000548707.1.15524 WP_000548707.1.15572 WP_000548707.1.15706 WP_000548707.1.1579 WP_000548707.1.15818 WP_000548707.1.1583 WP_000548707.1.15838 WP_000548707.1.15883 WP_000548707.1.15892 WP_000548707.1.15897 WP_000548707.1.15898 WP_000548707.1.15928 WP_000548707.1.15957 WP_000548707.1.15972 WP_000548707.1.1600 WP_000548707.1.1606 WP_000548707.1.16112 WP_000548707.1.16213 WP_000548707.1.16237 WP_000548707.1.16362 WP_000548707.1.16417 WP_000548707.1.16554 WP_000548707.1.16569 WP_000548707.1.16603 WP_000548707.1.16617 WP_000548707.1.16628 WP_000548707.1.16672 WP_000548707.1.16679 WP_000548707.1.16688 WP_000548707.1.16703 WP_000548707.1.16757 WP_000548707.1.16768 WP_000548707.1.16770 WP_000548707.1.16776 WP_000548707.1.16892 WP_000548707.1.16946 WP_000548707.1.17038 WP_000548707.1.17104 WP_000548707.1.17137 WP_000548707.1.17169 WP_000548707.1.17210 WP_000548707.1.17231 WP_000548707.1.17234 WP_000548707.1.17249 WP_000548707.1.17256 WP_000548707.1.17320 WP_000548707.1.17450 WP_000548707.1.17485 WP_000548707.1.17520 WP_000548707.1.17581 WP_000548707.1.17650 WP_000548707.1.17657 WP_000548707.1.17666 WP_000548707.1.17676 WP_000548707.1.17770 WP_000548707.1.17834 WP_000548707.1.17845 WP_000548707.1.17859 WP_000548707.1.17876 WP_000548707.1.17929 WP_000548707.1.17951 WP_000548707.1.18016 WP_000548707.1.18035 WP_000548707.1.18074 WP_000548707.1.18105 WP_000548707.1.18197 WP_000548707.1.18283 WP_000548707.1.18320 WP_000548707.1.1835 WP_000548707.1.18437 WP_000548707.1.18451 WP_000548707.1.1851 WP_000548707.1.18516 WP_000548707.1.18529 WP_000548707.1.18538 WP_000548707.1.18562 WP_000548707.1.18611 WP_000548707.1.18627 WP_000548707.1.18668 WP_000548707.1.18758 WP_000548707.1.18830 WP_000548707.1.18836 WP_000548707.1.18879 WP_000548707.1.18918 WP_000548707.1.18938 WP_000548707.1.18987 WP_000548707.1.19009 WP_000548707.1.1901 WP_000548707.1.19027 WP_000548707.1.19149 WP_000548707.1.19179 WP_000548707.1.192 WP_000548707.1.19272 WP_000548707.1.19390 WP_000548707.1.19411 WP_000548707.1.19444 WP_000548707.1.19509 WP_000548707.1.19733 WP_000548707.1.1975 WP_000548707.1.19765 WP_000548707.1.19775 WP_000548707.1.19807 WP_000548707.1.19853 WP_000548707.1.20057 WP_000548707.1.20101 WP_000548707.1.2013 WP_000548707.1.20155 WP_000548707.1.20160 WP_000548707.1.20210 WP_000548707.1.20235 WP_000548707.1.20354 WP_000548707.1.20386 WP_000548707.1.20473 WP_000548707.1.20554 WP_000548707.1.20772 WP_000548707.1.20833 WP_000548707.1.20838 WP_000548707.1.20860 WP_000548707.1.20975 WP_000548707.1.21013 WP_000548707.1.21054 WP_000548707.1.21080 WP_000548707.1.21081 WP_000548707.1.2128 WP_000548707.1.21312 WP_000548707.1.21356 WP_000548707.1.21386 WP_000548707.1.21402 WP_000548707.1.21465 WP_000548707.1.2154 WP_000548707.1.21601 WP_000548707.1.21679 WP_000548707.1.21712 WP_000548707.1.21820 WP_000548707.1.21901 WP_000548707.1.22045 WP_000548707.1.22163 WP_000548707.1.22165 WP_000548707.1.22170 WP_000548707.1.22174 WP_000548707.1.22246 WP_000548707.1.22332 WP_000548707.1.22344 WP_000548707.1.22351 WP_000548707.1.22367 WP_000548707.1.22526 WP_000548707.1.22551 WP_000548707.1.22657 WP_000548707.1.22730 WP_000548707.1.22731 WP_000548707.1.2280 WP_000548707.1.22811 WP_000548707.1.22843 WP_000548707.1.22859 WP_000548707.1.22994 WP_000548707.1.23004 WP_000548707.1.23152 WP_000548707.1.23228 WP_000548707.1.23238 WP_000548707.1.23381 WP_000548707.1.23420 WP_000548707.1.23450 WP_000548707.1.23489 WP_000548707.1.23491 WP_000548707.1.23541 WP_000548707.1.23544 WP_000548707.1.23586 WP_000548707.1.23613 WP_000548707.1.23626 WP_000548707.1.2365 WP_000548707.1.23822 WP_000548707.1.23849 WP_000548707.1.23907 WP_000548707.1.23935 WP_000548707.1.23998 WP_000548707.1.24148 WP_000548707.1.24167 WP_000548707.1.2423 WP_000548707.1.24241 WP_000548707.1.24279 WP_000548707.1.24364 WP_000548707.1.24418 WP_000548707.1.2442 WP_000548707.1.24443 WP_000548707.1.24478 WP_000548707.1.2458 WP_000548707.1.24617 WP_000548707.1.24745 WP_000548707.1.24781 WP_000548707.1.2480 WP_000548707.1.24802 WP_000548707.1.24891 WP_000548707.1.25083 WP_000548707.1.25170 WP_000548707.1.25438 WP_000548707.1.25469 WP_000548707.1.25479 WP_000548707.1.25511 WP_000548707.1.25567 WP_000548707.1.25593 WP_000548707.1.25634 WP_000548707.1.25737 WP_000548707.1.25770 WP_000548707.1.2579 WP_000548707.1.25867 WP_000548707.1.25868 WP_000548707.1.25881 WP_000548707.1.25891 WP_000548707.1.25924 WP_000548707.1.2593 WP_000548707.1.26006 WP_000548707.1.26015 WP_000548707.1.26293 WP_000548707.1.26307 WP_000548707.1.26370 WP_000548707.1.26405 WP_000548707.1.26481 WP_000548707.1.2658 WP_000548707.1.2661 WP_000548707.1.26626 WP_000548707.1.2664 WP_000548707.1.26663 WP_000548707.1.26733 WP_000548707.1.26771 WP_000548707.1.26790 WP_000548707.1.26927 WP_000548707.1.26958 WP_000548707.1.27042 WP_000548707.1.27154 WP_000548707.1.27246 WP_000548707.1.27311 WP_000548707.1.27333 WP_000548707.1.2734 WP_000548707.1.27455 WP_000548707.1.27457 WP_000548707.1.27551 WP_000548707.1.27562 WP_000548707.1.2759 WP_000548707.1.27608 WP_000548707.1.27614 WP_000548707.1.27615 WP_000548707.1.27621 WP_000548707.1.27654 WP_000548707.1.27670 WP_000548707.1.2768 WP_000548707.1.27717 WP_000548707.1.27748 WP_000548707.1.27854 WP_000548707.1.27950 WP_000548707.1.27953 WP_000548707.1.27972 WP_000548707.1.28007 WP_000548707.1.28025 WP_000548707.1.28063 WP_000548707.1.28071 WP_000548707.1.28088 WP_000548707.1.28117 WP_000548707.1.28138 WP_000548707.1.28147 WP_000548707.1.28158 WP_000548707.1.28191 WP_000548707.1.28207 WP_000548707.1.28360 WP_000548707.1.28376 WP_000548707.1.28381 WP_000548707.1.28477 WP_000548707.1.28498 WP_000548707.1.28502 WP_000548707.1.28527 WP_000548707.1.28532 WP_000548707.1.28650 WP_000548707.1.28710 WP_000548707.1.28725 WP_000548707.1.28862 WP_000548707.1.28887 WP_000548707.1.28933 WP_000548707.1.28960 WP_000548707.1.28970 WP_000548707.1.29090 WP_000548707.1.29107 WP_000548707.1.29188 WP_000548707.1.29207 WP_000548707.1.29272 WP_000548707.1.29282 WP_000548707.1.29285 WP_000548707.1.29312 WP_000548707.1.29372 WP_000548707.1.29381 WP_000548707.1.29511 WP_000548707.1.29541 WP_000548707.1.29596 WP_000548707.1.29644 WP_000548707.1.29676 WP_000548707.1.2975 WP_000548707.1.29758 WP_000548707.1.29781 WP_000548707.1.29805 WP_000548707.1.29885 WP_000548707.1.29963 WP_000548707.1.30012 WP_000548707.1.30023 WP_000548707.1.30033 WP_000548707.1.30047 WP_000548707.1.30057 WP_000548707.1.30154 WP_000548707.1.30274 WP_000548707.1.30333 WP_000548707.1.30367 WP_000548707.1.30376 WP_000548707.1.30381 WP_000548707.1.30418 WP_000548707.1.30422 WP_000548707.1.30477 WP_000548707.1.30530 WP_000548707.1.30623 WP_000548707.1.30758 WP_000548707.1.30779 WP_000548707.1.30862 WP_000548707.1.30863 WP_000548707.1.30874 WP_000548707.1.30878 WP_000548707.1.30889 WP_000548707.1.30916 WP_000548707.1.3097 WP_000548707.1.30970 WP_000548707.1.30971 WP_000548707.1.30998 WP_000548707.1.31037 WP_000548707.1.31068 WP_000548707.1.31124 WP_000548707.1.31194 WP_000548707.1.31232 WP_000548707.1.31376 WP_000548707.1.31462 WP_000548707.1.31478 WP_000548707.1.315 WP_000548707.1.31611 WP_000548707.1.31638 WP_000548707.1.31667 WP_000548707.1.31787 WP_000548707.1.31797 WP_000548707.1.31817 WP_000548707.1.31897 WP_000548707.1.31925 WP_000548707.1.31949 WP_000548707.1.31990 WP_000548707.1.31994 WP_000548707.1.32059 WP_000548707.1.32118 WP_000548707.1.32122 WP_000548707.1.32125 WP_000548707.1.32167 WP_000548707.1.32217 WP_000548707.1.32244 WP_000548707.1.32248 WP_000548707.1.32281 WP_000548707.1.32295 WP_000548707.1.32365 WP_000548707.1.32384 WP_000548707.1.32405 WP_000548707.1.3244 WP_000548707.1.32464 WP_000548707.1.32739 WP_000548707.1.32839 WP_000548707.1.32921 WP_000548707.1.32987 WP_000548707.1.3299 WP_000548707.1.3306 WP_000548707.1.33108 WP_000548707.1.33147 WP_000548707.1.33252 WP_000548707.1.33255 WP_000548707.1.33307 WP_000548707.1.3335 WP_000548707.1.33350 WP_000548707.1.33372 WP_000548707.1.3338 WP_000548707.1.33388 WP_000548707.1.33394 WP_000548707.1.33426 WP_000548707.1.3345 WP_000548707.1.33463 WP_000548707.1.33483 WP_000548707.1.33484 WP_000548707.1.33520 WP_000548707.1.33575 WP_000548707.1.33650 WP_000548707.1.33724 WP_000548707.1.33737 WP_000548707.1.33756 WP_000548707.1.33766 WP_000548707.1.33778 WP_000548707.1.33899 WP_000548707.1.33949 WP_000548707.1.33994 WP_000548707.1.34069 WP_000548707.1.34105 WP_000548707.1.34112 WP_000548707.1.3418 WP_000548707.1.34194 WP_000548707.1.34361 WP_000548707.1.3442 WP_000548707.1.34471 WP_000548707.1.34512 WP_000548707.1.34569 WP_000548707.1.34716 WP_000548707.1.3474 WP_000548707.1.34741 WP_000548707.1.34847 WP_000548707.1.34865 WP_000548707.1.34923 WP_000548707.1.34926 WP_000548707.1.34967 WP_000548707.1.35014 WP_000548707.1.35031 WP_000548707.1.35032 WP_000548707.1.35314 WP_000548707.1.35340 WP_000548707.1.35391 WP_000548707.1.35413 WP_000548707.1.35508 WP_000548707.1.35517 WP_000548707.1.35519 WP_000548707.1.35549 WP_000548707.1.35642 WP_000548707.1.35661 WP_000548707.1.35686 WP_000548707.1.35696 WP_000548707.1.35784 WP_000548707.1.3579 WP_000548707.1.35837 WP_000548707.1.35890 WP_000548707.1.35903 WP_000548707.1.36093 WP_000548707.1.36179 WP_000548707.1.36208 WP_000548707.1.36249 WP_000548707.1.36302 WP_000548707.1.36430 WP_000548707.1.36439 WP_000548707.1.36640 WP_000548707.1.36704 WP_000548707.1.36729 WP_000548707.1.36773 WP_000548707.1.36814 WP_000548707.1.36847 WP_000548707.1.36903 WP_000548707.1.36911 WP_000548707.1.3709 WP_000548707.1.37130 WP_000548707.1.37145 WP_000548707.1.37159 WP_000548707.1.3722 WP_000548707.1.37240 WP_000548707.1.37335 WP_000548707.1.37378 WP_000548707.1.37411 WP_000548707.1.37435 WP_000548707.1.37546 WP_000548707.1.37644 WP_000548707.1.37669 WP_000548707.1.3774 WP_000548707.1.37749 WP_000548707.1.37764 WP_000548707.1.37771 WP_000548707.1.37788 WP_000548707.1.37851 WP_000548707.1.37906 WP_000548707.1.37907 WP_000548707.1.37929 WP_000548707.1.38030 WP_000548707.1.38111 WP_000548707.1.38128 WP_000548707.1.38136 WP_000548707.1.38222 WP_000548707.1.38304 WP_000548707.1.38516 WP_000548707.1.38555 WP_000548707.1.38688 WP_000548707.1.3875 WP_000548707.1.38875 WP_000548707.1.38885 WP_000548707.1.38890 WP_000548707.1.38927 WP_000548707.1.39017 WP_000548707.1.39026 WP_000548707.1.39166 WP_000548707.1.39330 WP_000548707.1.39361 WP_000548707.1.39499 WP_000548707.1.39542 WP_000548707.1.39642 WP_000548707.1.39670 WP_000548707.1.39671 WP_000548707.1.39682 WP_000548707.1.39693 WP_000548707.1.39857 WP_000548707.1.39943 WP_000548707.1.39995 WP_000548707.1.40076 WP_000548707.1.4010 WP_000548707.1.40149 WP_000548707.1.40247 WP_000548707.1.40329 WP_000548707.1.40369 WP_000548707.1.40428 WP_000548707.1.40483 WP_000548707.1.40500 WP_000548707.1.40613 WP_000548707.1.40670 WP_000548707.1.40700 WP_000548707.1.40719 WP_000548707.1.40729 WP_000548707.1.40780 WP_000548707.1.40814 WP_000548707.1.40939 WP_000548707.1.40997 WP_000548707.1.41033 WP_000548707.1.41038 WP_000548707.1.4105 WP_000548707.1.41350 WP_000548707.1.41374 WP_000548707.1.41386 WP_000548707.1.41389 WP_000548707.1.41555 WP_000548707.1.41581 WP_000548707.1.41587 WP_000548707.1.41598 WP_000548707.1.41612 WP_000548707.1.41620 WP_000548707.1.41681 WP_000548707.1.4169 WP_000548707.1.41755 WP_000548707.1.41796 WP_000548707.1.4182 WP_000548707.1.41972 WP_000548707.1.42003 WP_000548707.1.4202 WP_000548707.1.42056 WP_000548707.1.42072 WP_000548707.1.42085 WP_000548707.1.42169 WP_000548707.1.42178 WP_000548707.1.42241 WP_000548707.1.4225 WP_000548707.1.42298 WP_000548707.1.42325 WP_000548707.1.42344 WP_000548707.1.42607 WP_000548707.1.42681 WP_000548707.1.42733 WP_000548707.1.42764 WP_000548707.1.42788 WP_000548707.1.42798 WP_000548707.1.42816 WP_000548707.1.42907 WP_000548707.1.42925 WP_000548707.1.42959 WP_000548707.1.42984 WP_000548707.1.42990 WP_000548707.1.43023 WP_000548707.1.43061 WP_000548707.1.43095 WP_000548707.1.43110 WP_000548707.1.43125 WP_000548707.1.43139 WP_000548707.1.43168 WP_000548707.1.43179 WP_000548707.1.43204 WP_000548707.1.43252 WP_000548707.1.43279 WP_000548707.1.43360 WP_000548707.1.43375 WP_000548707.1.43405 WP_000548707.1.43446 WP_000548707.1.43512 WP_000548707.1.43665 WP_000548707.1.43784 WP_000548707.1.4386 WP_000548707.1.43995 WP_000548707.1.44074 WP_000548707.1.44177 WP_000548707.1.44178 WP_000548707.1.44344 WP_000548707.1.44382 WP_000548707.1.44432 WP_000548707.1.44504 WP_000548707.1.44515 WP_000548707.1.44520 WP_000548707.1.44586 WP_000548707.1.44623 WP_000548707.1.44655 WP_000548707.1.44667 WP_000548707.1.447 WP_000548707.1.44715 WP_000548707.1.44856 WP_000548707.1.44876 WP_000548707.1.44892 WP_000548707.1.44940 WP_000548707.1.44993 WP_000548707.1.45042 WP_000548707.1.45080 WP_000548707.1.45091 WP_000548707.1.45094 WP_000548707.1.45140 WP_000548707.1.45157 WP_000548707.1.45162 WP_000548707.1.45242 WP_000548707.1.45267 WP_000548707.1.4527 WP_000548707.1.45281 WP_000548707.1.4545 WP_000548707.1.45450 WP_000548707.1.45456 WP_000548707.1.4546 WP_000548707.1.45542 WP_000548707.1.45555 WP_000548707.1.45574 WP_000548707.1.45610 WP_000548707.1.45763 WP_000548707.1.4577 WP_000548707.1.45773 WP_000548707.1.4582 WP_000548707.1.45859 WP_000548707.1.45862 WP_000548707.1.45874 WP_000548707.1.4597 WP_000548707.1.45972 WP_000548707.1.45977 WP_000548707.1.45979 WP_000548707.1.46037 WP_000548707.1.46050 WP_000548707.1.46062 WP_000548707.1.46078 WP_000548707.1.46171 WP_000548707.1.46185 WP_000548707.1.46248 WP_000548707.1.46333 WP_000548707.1.46339 WP_000548707.1.46353 WP_000548707.1.46529 WP_000548707.1.46619 WP_000548707.1.46648 WP_000548707.1.46720 WP_000548707.1.46736 WP_000548707.1.4680 WP_000548707.1.46906 WP_000548707.1.46914 WP_000548707.1.46929 WP_000548707.1.4694 WP_000548707.1.46947 WP_000548707.1.47002 WP_000548707.1.47107 WP_000548707.1.47111 WP_000548707.1.47282 WP_000548707.1.47334 WP_000548707.1.47408 WP_000548707.1.47459 WP_000548707.1.47522 WP_000548707.1.47617 WP_000548707.1.47669 WP_000548707.1.47680 WP_000548707.1.47747 WP_000548707.1.47851 WP_000548707.1.47908 WP_000548707.1.4792 WP_000548707.1.48046 WP_000548707.1.48064 WP_000548707.1.48067 WP_000548707.1.48116 WP_000548707.1.48142 WP_000548707.1.48156 WP_000548707.1.48187 WP_000548707.1.48223 WP_000548707.1.48272 WP_000548707.1.48282 WP_000548707.1.48310 WP_000548707.1.48338 WP_000548707.1.48398 WP_000548707.1.4840 WP_000548707.1.48427 WP_000548707.1.48437 WP_000548707.1.48438 WP_000548707.1.48479 WP_000548707.1.4852 WP_000548707.1.48580 WP_000548707.1.48664 WP_000548707.1.48670 WP_000548707.1.48723 WP_000548707.1.48769 WP_000548707.1.48782 WP_000548707.1.48869 WP_000548707.1.49018 WP_000548707.1.49071 WP_000548707.1.49094 WP_000548707.1.49105 WP_000548707.1.49171 WP_000548707.1.49196 WP_000548707.1.49199 WP_000548707.1.4924 WP_000548707.1.49257 WP_000548707.1.49301 WP_000548707.1.49326 WP_000548707.1.49362 WP_000548707.1.49418 WP_000548707.1.4945 WP_000548707.1.49518 WP_000548707.1.49549 WP_000548707.1.49581 WP_000548707.1.49582 WP_000548707.1.496 WP_000548707.1.49603 WP_000548707.1.49643 WP_000548707.1.49690 WP_000548707.1.49728 WP_000548707.1.49732 WP_000548707.1.49745 WP_000548707.1.49819 WP_000548707.1.49918 WP_000548707.1.49935 WP_000548707.1.50028 WP_000548707.1.50117 WP_000548707.1.50145 WP_000548707.1.50178 WP_000548707.1.50192 WP_000548707.1.50291 WP_000548707.1.50367 WP_000548707.1.50388 WP_000548707.1.5045 WP_000548707.1.50464 WP_000548707.1.50525 WP_000548707.1.50558 WP_000548707.1.50568 WP_000548707.1.5059 WP_000548707.1.50594 WP_000548707.1.50699 WP_000548707.1.50740 WP_000548707.1.50817 WP_000548707.1.50829 WP_000548707.1.50974 WP_000548707.1.51015 WP_000548707.1.51130 WP_000548707.1.51209 WP_000548707.1.51226 WP_000548707.1.51271 WP_000548707.1.51277 WP_000548707.1.51326 WP_000548707.1.51393 WP_000548707.1.51496 WP_000548707.1.51557 WP_000548707.1.51741 WP_000548707.1.51794 WP_000548707.1.51824 WP_000548707.1.52034 WP_000548707.1.52061 WP_000548707.1.52072 WP_000548707.1.52195 WP_000548707.1.52198 WP_000548707.1.52210 WP_000548707.1.52289 WP_000548707.1.52308 WP_000548707.1.52343 WP_000548707.1.52377 WP_000548707.1.52396 WP_000548707.1.52427 WP_000548707.1.52452 WP_000548707.1.5251 WP_000548707.1.52511 WP_000548707.1.52605 WP_000548707.1.52830 WP_000548707.1.52889 WP_000548707.1.52900 WP_000548707.1.52965 WP_000548707.1.52983 WP_000548707.1.5304 WP_000548707.1.53057 WP_000548707.1.5319 WP_000548707.1.53245 WP_000548707.1.53312 WP_000548707.1.53363 WP_000548707.1.53373 WP_000548707.1.53379 WP_000548707.1.53408 WP_000548707.1.53467 WP_000548707.1.5347 WP_000548707.1.53532 WP_000548707.1.53799 WP_000548707.1.53911 WP_000548707.1.54049 WP_000548707.1.54074 WP_000548707.1.54086 WP_000548707.1.54237 WP_000548707.1.54290 WP_000548707.1.54299 WP_000548707.1.54404 WP_000548707.1.54438 WP_000548707.1.54471 WP_000548707.1.54479 WP_000548707.1.54485 WP_000548707.1.54554 WP_000548707.1.54574 WP_000548707.1.54744 WP_000548707.1.54830 WP_000548707.1.54851 WP_000548707.1.54929 WP_000548707.1.54931 WP_000548707.1.54967 WP_000548707.1.54990 WP_000548707.1.5500 WP_000548707.1.55004 WP_000548707.1.55082 WP_000548707.1.55084 WP_000548707.1.55095 WP_000548707.1.55139 WP_000548707.1.5518 WP_000548707.1.552 WP_000548707.1.55239 WP_000548707.1.55271 WP_000548707.1.55327 WP_000548707.1.55336 WP_000548707.1.55419 WP_000548707.1.55495 WP_000548707.1.5550 WP_000548707.1.55527 WP_000548707.1.55535 WP_000548707.1.55603 WP_000548707.1.55719 WP_000548707.1.55724 WP_000548707.1.55845 WP_000548707.1.55955 WP_000548707.1.56003 WP_000548707.1.5604 WP_000548707.1.56064 WP_000548707.1.56106 WP_000548707.1.56135 WP_000548707.1.56159 WP_000548707.1.56200 WP_000548707.1.56220 WP_000548707.1.56237 WP_000548707.1.56265 WP_000548707.1.56387 WP_000548707.1.56464 WP_000548707.1.56482 WP_000548707.1.56527 WP_000548707.1.56542 WP_000548707.1.56608 WP_000548707.1.56619 WP_000548707.1.56702 WP_000548707.1.56708 WP_000548707.1.56737 WP_000548707.1.5675 WP_000548707.1.56779 WP_000548707.1.56822 WP_000548707.1.56903 WP_000548707.1.56931 WP_000548707.1.56966 WP_000548707.1.56975 WP_000548707.1.57015 WP_000548707.1.5705 WP_000548707.1.57081 WP_000548707.1.57115 WP_000548707.1.57141 WP_000548707.1.57330 WP_000548707.1.57427 WP_000548707.1.57448 WP_000548707.1.57593 WP_000548707.1.57670 WP_000548707.1.57693 WP_000548707.1.57701 WP_000548707.1.57718 WP_000548707.1.57727 WP_000548707.1.57745 WP_000548707.1.57783 WP_000548707.1.57844 WP_000548707.1.57962 WP_000548707.1.5799 WP_000548707.1.58006 WP_000548707.1.58051 WP_000548707.1.58122 WP_000548707.1.5817 WP_000548707.1.58185 WP_000548707.1.58198 WP_000548707.1.58241 WP_000548707.1.58246 WP_000548707.1.58325 WP_000548707.1.58350 WP_000548707.1.58353 WP_000548707.1.58366 WP_000548707.1.58392 WP_000548707.1.58421 WP_000548707.1.5849 WP_000548707.1.58508 WP_000548707.1.58521 WP_000548707.1.58603 WP_000548707.1.58714 WP_000548707.1.58775 WP_000548707.1.58936 WP_000548707.1.58998 WP_000548707.1.5901 WP_000548707.1.5904 WP_000548707.1.59133 WP_000548707.1.5925 WP_000548707.1.59269 WP_000548707.1.59284 WP_000548707.1.59327 WP_000548707.1.59363 WP_000548707.1.59397 WP_000548707.1.59457 WP_000548707.1.59459 WP_000548707.1.59478 WP_000548707.1.59609 WP_000548707.1.59629 WP_000548707.1.59663 WP_000548707.1.59697 WP_000548707.1.59803 WP_000548707.1.59881 WP_000548707.1.59886 WP_000548707.1.59977 WP_000548707.1.60022 WP_000548707.1.60086 WP_000548707.1.60156 WP_000548707.1.60181 WP_000548707.1.60251 WP_000548707.1.60259 WP_000548707.1.60280 WP_000548707.1.60307 WP_000548707.1.60368 WP_000548707.1.60462 WP_000548707.1.60515 WP_000548707.1.60551 WP_000548707.1.60594 WP_000548707.1.60690 WP_000548707.1.60696 WP_000548707.1.60787 WP_000548707.1.60898 WP_000548707.1.60939 WP_000548707.1.60981 WP_000548707.1.61030 WP_000548707.1.61119 WP_000548707.1.61152 WP_000548707.1.61153 WP_000548707.1.6118 WP_000548707.1.61188 WP_000548707.1.61257 WP_000548707.1.61324 WP_000548707.1.61339 WP_000548707.1.61413 WP_000548707.1.61421 WP_000548707.1.61547 WP_000548707.1.6168 WP_000548707.1.61784 WP_000548707.1.61910 WP_000548707.1.61970 WP_000548707.1.62030 WP_000548707.1.62140 WP_000548707.1.62164 WP_000548707.1.62367 WP_000548707.1.62409 WP_000548707.1.62459 WP_000548707.1.62537 WP_000548707.1.62539 WP_000548707.1.62575 WP_000548707.1.62685 WP_000548707.1.62740 WP_000548707.1.62756 WP_000548707.1.62781 WP_000548707.1.62796 WP_000548707.1.62808 WP_000548707.1.62829 WP_000548707.1.62842 WP_000548707.1.62878 WP_000548707.1.62956 WP_000548707.1.63011 WP_000548707.1.63050 WP_000548707.1.631 WP_000548707.1.63195 WP_000548707.1.63233 WP_000548707.1.63244 WP_000548707.1.63279 WP_000548707.1.63296 WP_000548707.1.63307 WP_000548707.1.63319 WP_000548707.1.63324 WP_000548707.1.63335 WP_000548707.1.63337 WP_000548707.1.63383 WP_000548707.1.63406 WP_000548707.1.63411 WP_000548707.1.63421 WP_000548707.1.63460 WP_000548707.1.63510 WP_000548707.1.63527 WP_000548707.1.63565 WP_000548707.1.63617 WP_000548707.1.63693 WP_000548707.1.6378 WP_000548707.1.63847 WP_000548707.1.63894 WP_000548707.1.64012 WP_000548707.1.64094 WP_000548707.1.64108 WP_000548707.1.64207 WP_000548707.1.64251 WP_000548707.1.64303 WP_000548707.1.64368 WP_000548707.1.64628 WP_000548707.1.64643 WP_000548707.1.64811 WP_000548707.1.64845 WP_000548707.1.64860 WP_000548707.1.64951 WP_000548707.1.64956 WP_000548707.1.64996 WP_000548707.1.64998 WP_000548707.1.65025 WP_000548707.1.65038 WP_000548707.1.65076 WP_000548707.1.65233 WP_000548707.1.65264 WP_000548707.1.65358 WP_000548707.1.65406 WP_000548707.1.65407 WP_000548707.1.6544 WP_000548707.1.65448 WP_000548707.1.65585 WP_000548707.1.65616 WP_000548707.1.65629 WP_000548707.1.65643 WP_000548707.1.65656 WP_000548707.1.6568 WP_000548707.1.65713 WP_000548707.1.65734 WP_000548707.1.65769 WP_000548707.1.65809 WP_000548707.1.6585 WP_000548707.1.65892 WP_000548707.1.65935 WP_000548707.1.65947 WP_000548707.1.65965 WP_000548707.1.6603 WP_000548707.1.66054 WP_000548707.1.66069 WP_000548707.1.66073 WP_000548707.1.66144 WP_000548707.1.66265 WP_000548707.1.66298 WP_000548707.1.6632 WP_000548707.1.66366 WP_000548707.1.66453 WP_000548707.1.66513 WP_000548707.1.66556 WP_000548707.1.66598 WP_000548707.1.66611 WP_000548707.1.66614 WP_000548707.1.66705 WP_000548707.1.66756 WP_000548707.1.66766 WP_000548707.1.66803 WP_000548707.1.66816 WP_000548707.1.6688 WP_000548707.1.66938 WP_000548707.1.66969 WP_000548707.1.67012 WP_000548707.1.67014 WP_000548707.1.67067 WP_000548707.1.67072 WP_000548707.1.67113 WP_000548707.1.67155 WP_000548707.1.67160 WP_000548707.1.67238 WP_000548707.1.67259 WP_000548707.1.6726 WP_000548707.1.67286 WP_000548707.1.67294 WP_000548707.1.67312 WP_000548707.1.67328 WP_000548707.1.67418 WP_000548707.1.67420 WP_000548707.1.67425 WP_000548707.1.67457 WP_000548707.1.67460 WP_000548707.1.67540 WP_000548707.1.67571 WP_000548707.1.67621 WP_000548707.1.67644 WP_000548707.1.67653 WP_000548707.1.67691 WP_000548707.1.67806 WP_000548707.1.67834 WP_000548707.1.67867 WP_000548707.1.67880 WP_000548707.1.67900 WP_000548707.1.67991 WP_000548707.1.68134 WP_000548707.1.68141 WP_000548707.1.68152 WP_000548707.1.68202 WP_000548707.1.68221 WP_000548707.1.68223 WP_000548707.1.6824 WP_000548707.1.68268 WP_000548707.1.68355 WP_000548707.1.68366 WP_000548707.1.68398 WP_000548707.1.68399 WP_000548707.1.68476 WP_000548707.1.68479 WP_000548707.1.68504 WP_000548707.1.68512 WP_000548707.1.68548 WP_000548707.1.686 WP_000548707.1.68681 WP_000548707.1.68683 WP_000548707.1.68741 WP_000548707.1.68743 WP_000548707.1.68883 WP_000548707.1.68998 WP_000548707.1.69012 WP_000548707.1.69071 WP_000548707.1.69078 WP_000548707.1.69105 WP_000548707.1.6915 WP_000548707.1.69198 WP_000548707.1.69213 WP_000548707.1.69349 WP_000548707.1.69394 WP_000548707.1.69437 WP_000548707.1.69475 WP_000548707.1.69490 WP_000548707.1.69546 WP_000548707.1.69598 WP_000548707.1.6968 WP_000548707.1.69683 WP_000548707.1.69724 WP_000548707.1.69734 WP_000548707.1.6980 WP_000548707.1.69820 WP_000548707.1.69823 WP_000548707.1.69830 WP_000548707.1.699 WP_000548707.1.69902 WP_000548707.1.69934 WP_000548707.1.69980 WP_000548707.1.69995 WP_000548707.1.70059 WP_000548707.1.70161 WP_000548707.1.70220 WP_000548707.1.70225 WP_000548707.1.70228 WP_000548707.1.70294 WP_000548707.1.70311 WP_000548707.1.70313 WP_000548707.1.70334 WP_000548707.1.70448 WP_000548707.1.7046 WP_000548707.1.70487 WP_000548707.1.70495 WP_000548707.1.70527 WP_000548707.1.70558 WP_000548707.1.70564 WP_000548707.1.7064 WP_000548707.1.70664 WP_000548707.1.707 WP_000548707.1.70721 WP_000548707.1.70763 WP_000548707.1.70808 WP_000548707.1.70835 WP_000548707.1.70843 WP_000548707.1.70909 WP_000548707.1.70926 WP_000548707.1.710 WP_000548707.1.71016 WP_000548707.1.7105 WP_000548707.1.71208 WP_000548707.1.71231 WP_000548707.1.71267 WP_000548707.1.71313 WP_000548707.1.71410 WP_000548707.1.71467 WP_000548707.1.71475 WP_000548707.1.71715 WP_000548707.1.71721 WP_000548707.1.71737 WP_000548707.1.71739 WP_000548707.1.71741 WP_000548707.1.71863 WP_000548707.1.71877 WP_000548707.1.71892 WP_000548707.1.71899 WP_000548707.1.71910 WP_000548707.1.71978 WP_000548707.1.72002 WP_000548707.1.72018 WP_000548707.1.72148 WP_000548707.1.722 WP_000548707.1.72204 WP_000548707.1.72306 WP_000548707.1.72340 WP_000548707.1.72363 WP_000548707.1.72371 WP_000548707.1.72453 WP_000548707.1.72465 WP_000548707.1.72497 WP_000548707.1.7258 WP_000548707.1.7260 WP_000548707.1.72649 WP_000548707.1.72666 WP_000548707.1.72708 WP_000548707.1.72719 WP_000548707.1.72753 WP_000548707.1.72762 WP_000548707.1.72881 WP_000548707.1.72930 WP_000548707.1.72961 WP_000548707.1.72991 WP_000548707.1.73002 WP_000548707.1.73021 WP_000548707.1.73087 WP_000548707.1.73140 WP_000548707.1.73190 WP_000548707.1.73195 WP_000548707.1.73201 WP_000548707.1.73211 WP_000548707.1.73240 WP_000548707.1.73241 WP_000548707.1.73264 WP_000548707.1.73401 WP_000548707.1.73420 WP_000548707.1.73450 WP_000548707.1.73464 WP_000548707.1.73513 WP_000548707.1.73539 WP_000548707.1.7360 WP_000548707.1.73610 WP_000548707.1.7365 WP_000548707.1.73674 WP_000548707.1.73694 WP_000548707.1.73740 WP_000548707.1.73789 WP_000548707.1.73885 WP_000548707.1.73900 WP_000548707.1.73921 WP_000548707.1.73940 WP_000548707.1.73949 WP_000548707.1.73971 WP_000548707.1.74004 WP_000548707.1.7401 WP_000548707.1.7406 WP_000548707.1.74073 WP_000548707.1.74085 WP_000548707.1.74257 WP_000548707.1.74284 WP_000548707.1.74295 WP_000548707.1.74327 WP_000548707.1.74456 WP_000548707.1.74468 WP_000548707.1.74576 WP_000548707.1.74676 WP_000548707.1.74681 WP_000548707.1.74758 WP_000548707.1.74770 WP_000548707.1.74785 WP_000548707.1.74797 WP_000548707.1.7482 WP_000548707.1.74874 WP_000548707.1.75070 WP_000548707.1.75111 WP_000548707.1.75131 WP_000548707.1.75132 WP_000548707.1.75323 WP_000548707.1.75356 WP_000548707.1.75409 WP_000548707.1.75538 WP_000548707.1.75566 WP_000548707.1.75571 WP_000548707.1.75647 WP_000548707.1.75692 WP_000548707.1.75728 WP_000548707.1.75743 WP_000548707.1.75800 WP_000548707.1.75809 WP_000548707.1.75840 WP_000548707.1.75862 WP_000548707.1.75910 WP_000548707.1.7602 WP_000548707.1.76049 WP_000548707.1.76050 WP_000548707.1.76053 WP_000548707.1.76111 WP_000548707.1.76114 WP_000548707.1.76121 WP_000548707.1.76153 WP_000548707.1.76179 WP_000548707.1.7627 WP_000548707.1.76313 WP_000548707.1.76424 WP_000548707.1.76426 WP_000548707.1.76431 WP_000548707.1.76463 WP_000548707.1.76497 WP_000548707.1.76674 WP_000548707.1.76711 WP_000548707.1.76718 WP_000548707.1.76803 WP_000548707.1.76829 WP_000548707.1.7694 WP_000548707.1.77043 WP_000548707.1.77072 WP_000548707.1.77137 WP_000548707.1.77158 WP_000548707.1.77187 WP_000548707.1.77190 WP_000548707.1.77203 WP_000548707.1.77229 WP_000548707.1.77297 WP_000548707.1.77298 WP_000548707.1.77331 WP_000548707.1.77346 WP_000548707.1.77359 WP_000548707.1.77388 WP_000548707.1.77532 WP_000548707.1.77650 WP_000548707.1.77735 WP_000548707.1.77791 WP_000548707.1.7785 WP_000548707.1.7786 WP_000548707.1.77882 WP_000548707.1.77893 WP_000548707.1.77915 WP_000548707.1.77922 WP_000548707.1.77930 WP_000548707.1.77986 WP_000548707.1.78038 WP_000548707.1.78082 WP_000548707.1.78093 WP_000548707.1.78164 WP_000548707.1.78179 WP_000548707.1.78304 WP_000548707.1.78330 WP_000548707.1.78335 WP_000548707.1.78371 WP_000548707.1.78434 WP_000548707.1.78436 WP_000548707.1.78470 WP_000548707.1.78489 WP_000548707.1.78494 WP_000548707.1.7853 WP_000548707.1.78573 WP_000548707.1.78585 WP_000548707.1.78592 WP_000548707.1.78662 WP_000548707.1.78685 WP_000548707.1.78736 WP_000548707.1.78758 WP_000548707.1.78763 WP_000548707.1.78816 WP_000548707.1.78920 WP_000548707.1.78937 WP_000548707.1.78991 WP_000548707.1.78995 WP_000548707.1.7905 WP_000548707.1.79110 WP_000548707.1.7914 WP_000548707.1.79143 WP_000548707.1.79178 WP_000548707.1.79192 WP_000548707.1.79275 WP_000548707.1.79285 WP_000548707.1.79378 WP_000548707.1.79552 WP_000548707.1.79581 WP_000548707.1.79627 WP_000548707.1.79677 WP_000548707.1.79731 WP_000548707.1.79763 WP_000548707.1.7981 WP_000548707.1.79815 WP_000548707.1.79904 WP_000548707.1.79949 WP_000548707.1.80009 WP_000548707.1.80029 WP_000548707.1.80086 WP_000548707.1.80119 WP_000548707.1.80120 WP_000548707.1.80122 WP_000548707.1.80146 WP_000548707.1.80178 WP_000548707.1.80184 WP_000548707.1.80210 WP_000548707.1.80244 WP_000548707.1.80274 WP_000548707.1.80316 WP_000548707.1.80361 WP_000548707.1.80389 WP_000548707.1.8040 WP_000548707.1.80434 WP_000548707.1.8045 WP_000548707.1.80521 WP_000548707.1.80582 WP_000548707.1.80745 WP_000548707.1.80899 WP_000548707.1.81022 WP_000548707.1.81049 WP_000548707.1.81052 WP_000548707.1.81064 WP_000548707.1.81095 WP_000548707.1.81132 WP_000548707.1.81151 WP_000548707.1.81172 WP_000548707.1.81176 WP_000548707.1.81184 WP_000548707.1.81214 WP_000548707.1.81228 WP_000548707.1.81232 WP_000548707.1.81290 WP_000548707.1.81379 WP_000548707.1.81508 WP_000548707.1.81574 WP_000548707.1.8160 WP_000548707.1.81604 WP_000548707.1.81619 WP_000548707.1.81645 WP_000548707.1.8180 WP_000548707.1.81837 WP_000548707.1.81838 WP_000548707.1.8185 WP_000548707.1.81969 WP_000548707.1.81990 WP_000548707.1.8206 WP_000548707.1.82103 WP_000548707.1.8213 WP_000548707.1.82174 WP_000548707.1.82184 WP_000548707.1.82253 WP_000548707.1.82281 WP_000548707.1.82301 WP_000548707.1.82349 WP_000548707.1.82406 WP_000548707.1.82458 WP_000548707.1.82468 WP_000548707.1.82525 WP_000548707.1.82535 WP_000548707.1.82558 WP_000548707.1.82768 WP_000548707.1.82824 WP_000548707.1.82855 WP_000548707.1.82930 WP_000548707.1.82941 WP_000548707.1.83046 WP_000548707.1.83054 WP_000548707.1.83078 WP_000548707.1.83086 WP_000548707.1.83103 WP_000548707.1.8318 WP_000548707.1.83203 WP_000548707.1.83291 WP_000548707.1.83359 WP_000548707.1.83405 WP_000548707.1.83417 WP_000548707.1.8346 WP_000548707.1.83467 WP_000548707.1.83472 WP_000548707.1.83479 WP_000548707.1.83520 WP_000548707.1.83553 WP_000548707.1.8366 WP_000548707.1.83674 WP_000548707.1.83728 WP_000548707.1.83750 WP_000548707.1.83756 WP_000548707.1.83758 WP_000548707.1.83788 WP_000548707.1.83797 WP_000548707.1.83844 WP_000548707.1.8385 WP_000548707.1.83886 WP_000548707.1.83989 WP_000548707.1.84025 WP_000548707.1.84054 WP_000548707.1.84118 WP_000548707.1.84129 WP_000548707.1.84161 WP_000548707.1.84188 WP_000548707.1.84275 WP_000548707.1.84415 WP_000548707.1.84418 WP_000548707.1.84590 WP_000548707.1.84596 WP_000548707.1.84608 WP_000548707.1.8462 WP_000548707.1.84648 WP_000548707.1.84651 WP_000548707.1.84696 WP_000548707.1.84826 WP_000548707.1.84847 WP_000548707.1.84854 WP_000548707.1.84924 WP_000548707.1.8496 WP_000548707.1.84975 WP_000548707.1.84978 WP_000548707.1.85017 WP_000548707.1.85026 WP_000548707.1.85045 WP_000548707.1.85070 WP_000548707.1.85118 WP_000548707.1.85229 WP_000548707.1.85289 WP_000548707.1.85375 WP_000548707.1.85376 WP_000548707.1.85409 WP_000548707.1.85441 WP_000548707.1.85485 WP_000548707.1.85585 WP_000548707.1.85611 WP_000548707.1.85730 WP_000548707.1.85732 WP_000548707.1.85858 WP_000548707.1.85906 WP_000548707.1.85924 WP_000548707.1.85971 WP_000548707.1.85980 WP_000548707.1.86036 WP_000548707.1.86042 WP_000548707.1.86086 WP_000548707.1.862 WP_000548707.1.86209 WP_000548707.1.86281 WP_000548707.1.86315 WP_000548707.1.8636 WP_000548707.1.86363 WP_000548707.1.86390 WP_000548707.1.86473 WP_000548707.1.86531 WP_000548707.1.86664 WP_000548707.1.86704 WP_000548707.1.86736 WP_000548707.1.86745 WP_000548707.1.86779 WP_000548707.1.86793 WP_000548707.1.86795 WP_000548707.1.8690 WP_000548707.1.86968 WP_000548707.1.86999 WP_000548707.1.87088 WP_000548707.1.87097 WP_000548707.1.87100 WP_000548707.1.87133 WP_000548707.1.87137 WP_000548707.1.87168 WP_000548707.1.87190 WP_000548707.1.87204 WP_000548707.1.87221 WP_000548707.1.87296 WP_000548707.1.87363 WP_000548707.1.87372 WP_000548707.1.87388 WP_000548707.1.87486 WP_000548707.1.87511 WP_000548707.1.87595 WP_000548707.1.8764 WP_000548707.1.87734 WP_000548707.1.87745 WP_000548707.1.87841 WP_000548707.1.87854 WP_000548707.1.87865 WP_000548707.1.87937 WP_000548707.1.87967 WP_000548707.1.88169 WP_000548707.1.88309 WP_000548707.1.88375 WP_000548707.1.88418 WP_000548707.1.88430 WP_000548707.1.88440 WP_000548707.1.88449 WP_000548707.1.8847 WP_000548707.1.88563 WP_000548707.1.88585 WP_000548707.1.8859 WP_000548707.1.88600 WP_000548707.1.88614 WP_000548707.1.88696 WP_000548707.1.88771 WP_000548707.1.88781 WP_000548707.1.88843 WP_000548707.1.88878 WP_000548707.1.88954 WP_000548707.1.88960 WP_000548707.1.88962 WP_000548707.1.89012 WP_000548707.1.89024 WP_000548707.1.89036 WP_000548707.1.89125 WP_000548707.1.89164 WP_000548707.1.8918 WP_000548707.1.89184 WP_000548707.1.89262 WP_000548707.1.89290 WP_000548707.1.89348 WP_000548707.1.89350 WP_000548707.1.89390 WP_000548707.1.89404 WP_000548707.1.89433 WP_000548707.1.89779 WP_000548707.1.89794 WP_000548707.1.89863 WP_000548707.1.89908 WP_000548707.1.89949 WP_000548707.1.89950 WP_000548707.1.90069 WP_000548707.1.90173 WP_000548707.1.90174 WP_000548707.1.90217 WP_000548707.1.90246 WP_000548707.1.90250 WP_000548707.1.90386 WP_000548707.1.90447 WP_000548707.1.90454 WP_000548707.1.90475 WP_000548707.1.90488 WP_000548707.1.90506 WP_000548707.1.90533 WP_000548707.1.90556 WP_000548707.1.90661 WP_000548707.1.90698 WP_000548707.1.9076 WP_000548707.1.91005 WP_000548707.1.91019 WP_000548707.1.91150 WP_000548707.1.9122 WP_000548707.1.91280 WP_000548707.1.91287 WP_000548707.1.91371 WP_000548707.1.91447 WP_000548707.1.91486 WP_000548707.1.91525 WP_000548707.1.91530 WP_000548707.1.9155 WP_000548707.1.91586 WP_000548707.1.91611 WP_000548707.1.91634 WP_000548707.1.91670 WP_000548707.1.917 WP_000548707.1.91704 WP_000548707.1.91745 WP_000548707.1.91848 WP_000548707.1.91918 WP_000548707.1.91969 WP_000548707.1.92125 WP_000548707.1.92186 WP_000548707.1.92212 WP_000548707.1.92228 WP_000548707.1.92244 WP_000548707.1.92249 WP_000548707.1.92303 WP_000548707.1.92391 WP_000548707.1.92405 WP_000548707.1.92425 WP_000548707.1.9247 WP_000548707.1.92512 WP_000548707.1.92667 WP_000548707.1.92674 WP_000548707.1.92718 WP_000548707.1.92765 WP_000548707.1.92795 WP_000548707.1.9286 WP_000548707.1.92965 WP_000548707.1.93047 WP_000548707.1.93071 WP_000548707.1.93147 WP_000548707.1.93197 WP_000548707.1.93243 WP_000548707.1.93254 WP_000548707.1.93260 WP_000548707.1.93378 WP_000548707.1.93471 WP_000548707.1.93567 WP_000548707.1.93579 WP_000548707.1.93708 WP_000548707.1.93758 WP_000548707.1.93762 WP_000548707.1.93775 WP_000548707.1.93890 WP_000548707.1.94 WP_000548707.1.94053 WP_000548707.1.94080 WP_000548707.1.94122 WP_000548707.1.94123 WP_000548707.1.94130 WP_000548707.1.94242 WP_000548707.1.94248 WP_000548707.1.94268 WP_000548707.1.94287 WP_000548707.1.9430 WP_000548707.1.94320 WP_000548707.1.94324 WP_000548707.1.94337 WP_000548707.1.94341 WP_000548707.1.94505 WP_000548707.1.94536 WP_000548707.1.9455 WP_000548707.1.947 WP_000548707.1.94825 WP_000548707.1.94969 WP_000548707.1.95008 WP_000548707.1.95023 WP_000548707.1.95029 WP_000548707.1.95033 WP_000548707.1.95156 WP_000548707.1.95193 WP_000548707.1.95263 WP_000548707.1.95281 WP_000548707.1.95294 WP_000548707.1.95386 WP_000548707.1.95494 WP_000548707.1.95512 WP_000548707.1.95519 WP_000548707.1.95522 WP_000548707.1.95560 WP_000548707.1.9563 WP_000548707.1.95683 WP_000548707.1.95780 WP_000548707.1.95832 WP_000548707.1.959 WP_000548707.1.95962 WP_000548707.1.96160 WP_000548707.1.96163 WP_000548707.1.96209 WP_000548707.1.96218 WP_000548707.1.96271 WP_000548707.1.96305 WP_000548707.1.96316 WP_000548707.1.96468 WP_000548707.1.96568 WP_000548707.1.96646 WP_000548707.1.96688 WP_000548707.1.96727 WP_000548707.1.96770 WP_000548707.1.96804 WP_000548707.1.96895 WP_000548707.1.96918 WP_000548707.1.9695 WP_000548707.1.96976 WP_000548707.1.97001 WP_000548707.1.97007 WP_000548707.1.97072 WP_000548707.1.97117 WP_000548707.1.97138 WP_000548707.1.97139 WP_000548707.1.97191 WP_000548707.1.97267 WP_000548707.1.97295 WP_000548707.1.97411 WP_000548707.1.97536 WP_000548707.1.97574 WP_000548707.1.97627 WP_000548707.1.97731 WP_000548707.1.97739 WP_000548707.1.97758 WP_000548707.1.97786 WP_000548707.1.97827 WP_000548707.1.97835 WP_000548707.1.9789 WP_000548707.1.97899 WP_000548707.1.97928 WP_000548707.1.97999 WP_000548707.1.98011 WP_000548707.1.98033 WP_000548707.1.98051 WP_000548707.1.98242 WP_000548707.1.98361 WP_000548707.1.98379 WP_000548707.1.98411 WP_000548707.1.98415 WP_000548707.1.98456 WP_000548707.1.98512 WP_000548707.1.98552 WP_000548707.1.986 WP_000548707.1.98655 WP_000548707.1.98706 WP_000548707.1.98767 WP_000548707.1.98837 WP_000548707.1.98858 WP_000548707.1.98874 WP_000548707.1.98967 WP_000548707.1.99009 WP_000548707.1.99025 WP_000548707.1.99155 WP_000548707.1.99171 WP_000548707.1.99249 WP_000548707.1.99280 WP_000548707.1.99359 WP_000548707.1.9936 WP_000548707.1.99405 WP_000548707.1.99430 WP_000548707.1.99459 WP_000548707.1.99492 WP_000548707.1.99494 WP_000548707.1.99519 WP_000548707.1.99536 WP_000548707.1.99538 WP_000548707.1.99564 WP_000548707.1.99569 WP_000548707.1.9960 WP_000548707.1.99631 WP_000548707.1.99638 WP_000548707.1.99686 WP_000548707.1.99759 WP_000548707.1.99802 WP_000548707.1.99850 WP_000548707.1.99860 WP_000548707.1.9987 WP_000548707.1.99926 WP_000548707.1.99956 WP_000548707.1.99979 WP_000548707.1.99985 YP_501079.1.76163 gi|387144042|ref|YP_005732436.1| gi|554645236|ref|YP_008717027.1| 426430.NWMN_2241 451515.SAUSA300_2287 451516.USA300HOU_2322 93061.SAOUHSC_02618 93062.SACOL2334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]