SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 452637.Oter_0640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  452637.Oter_0640
Domain Number - Region: 101-132
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0235
Family NfeD domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452637.Oter_0640
Sequence length 169
Comment (Opitutus terrae PB90 1)
Sequence
MLIAAVIGLAVVARVHAAAAADISTSEKRRPSLELAERLAQPPNLAPLPGELVHPFNPAA
FGQPDPEELRAIAAAQAAAQAAQTATKPTTDREFLQVIAARIMPSGTVIIGDEPWLIFGK
KRLRVGDRLTVAYDGQDYQLELAGIDRTNFTLRLNRDEITRPIKPRKTP
Download sequence
Identical sequences B1ZTI5
WP_012373468.1.87878 452637.Oter_0640 gi|182412464|ref|YP_001817530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]