SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 452637.Oter_2806 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452637.Oter_2806
Domain Number 1 Region: 133-335
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.13e-35
Family D-glucarate dehydratase-like 0.0019
Further Details:      
 
Domain Number 2 Region: 5-102
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.16e-19
Family Enolase N-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452637.Oter_2806
Sequence length 363
Comment (Opitutus terrae PB90 1)
Sequence
MRLGFAYRRYRLRFRAPVRTAHGVWTEREGVWVRLCDEAGHAGYGEAAPIPWFGTETIGQ
TEAVARAIGPKLDANDEESLADAAVEAPCLVNALRSAWHGLQEESRRTTGHASAATQADD
PTEFRSVAALLPAGRAALGVITEKAEAGFRVFKWKVGVANVGDELVLLDDVCAALPDGAK
LRLDANGAWDRRQAERWLERCAERPIEFVEQPCLAAAAEAPAQRRKIEDTLRGLAEDYPT
PIALDESLVVDGDVARWLAEGWRGVFVLKPALLAAPWTAVAKLAAAKASVVFSSALETIV
GARAALHLAFTWPGERKALGFGVWPLFAESRCDGPTAAPFLRWSDVKRLDPARAWAALEE
KAS
Download sequence
Identical sequences B1ZW04
WP_012375622.1.87878 NYSGXRC-9746a gi|182414621|ref|YP_001819687.1| 452637.Oter_2806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]