SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 452637.Oter_4319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452637.Oter_4319
Domain Number 1 Region: 7-163
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 452637.Oter_4319
Sequence length 172
Comment (Opitutus terrae PB90 1)
Sequence
MTTPDTVTNIVVAGLGGQGVIKASDLIAAAAFAAGLDVKKSEIHGMSQRGGSVASDVRFG
RRVLSPMVPVGEADFLLVVAPDQVDNNRYVLRPGGVLLEPSLLDAVKLASPRTLNVALVG
ALSAFLPFDAAVWRAALDATLASKIRAINDAAFAAGRTLGEQLAATRSAAAG
Download sequence
Identical sequences B1ZPA2
452637.Oter_4319 gi|182416125|ref|YP_001821191.1| WP_012377117.1.87878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]