SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 452863.Achl_0125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452863.Achl_0125
Domain Number 1 Region: 27-171
Classification Level Classification E-value
Superfamily Regulatory protein AraC 1.1e-16
Family Regulatory protein AraC 0.0055
Further Details:      
 
Domain Number 2 Region: 237-285
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000323
Family AraC type transcriptional activator 0.017
Further Details:      
 
Domain Number 3 Region: 186-229
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000323
Family AraC type transcriptional activator 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452863.Achl_0125
Sequence length 288
Comment (Arthrobacter chlorophenolicus A6)
Sequence
MARATGFQNQRLVVVPRPLVRDALSRPITRHLVVTDAGVFPAAADHGRHRPDGAAETIVI
LCVAGAGWVETGGMRTAVGAPAAVVLPGGTGEAHAYGAAEGDPWTIWWCHVRGADVPDLL
EGAGVRGAQVIPLVAVDRLTAMLDEIITALEKDQSPARLMATAGMAWRLLTALAIDRRLP
EKGTPLQQAMNYLEERVDGSVRLADLAALVGVSSSYLSKLFREATGGGVLAHHTALKMAR
ARLLLDTTDLPIAEVGREIGLQDQFYFSRQFRRLHGVSPSAYRAERKG
Download sequence
Identical sequences B8H8F4
WP_012630864.1.59127 WP_012630864.1.81542 gi|220910908|ref|YP_002486217.1| 452863.Achl_0125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]