SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 452863.Achl_2097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452863.Achl_2097
Domain Number 1 Region: 138-401
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-68
Family D-glucarate dehydratase-like 0.0000132
Further Details:      
 
Domain Number 2 Region: 19-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.47e-19
Family Enolase N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452863.Achl_2097
Sequence length 429
Comment (Arthrobacter chlorophenolicus A6)
Sequence
MTASTTVPAPSTPTATDLAITDITITPIAFSDPPLLNAVGVHEPLVHRVVIEVRTANGLL
GLGECSGGSTRLKNLAAGANAIKGVSIFETSRMEQLINQALDPGLGAFERAAVFSAFEVA
ALDIQGHATGRTVSELLGGTVRDEVPFSAYLFYKWAEHPALDGKPAITDDWGEALDPAGI
VRQAQKMISEYGFKSIKLKGGVFPPAQEIEAIQALRDAFPGMPLRLDPNTAWTVETSRWV
ARETEGLLEYLEDPTPGLEGMGEVAATAAMPLATNMCVVAFEHIRRGVELGSVQVILGDH
HYWGGLRHTRELGAICETFGLGLSMHSNSHLGISLAAMVHVAAATPALTYACDTHYPWNG
HNDVVKPGTLRFVDGSVRVPTGTGLGIELDREKLAELHRQYLDARMTARDDTGYMQRFVP
EYTADLPRW
Download sequence
Identical sequences B8H9J7
WP_015937284.1.59127 WP_015937284.1.81542 452863.Achl_2097 gi|220912846|ref|YP_002488155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]