SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI106903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI106903
Domain Number 1 Region: 97-202
Classification Level Classification E-value
Superfamily PUA domain-like 1.07e-32
Family LON domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 3-51
Classification Level Classification E-value
Superfamily RING/U-box 5.2e-17
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Weak hits

Sequence:  45351.JGI106903
Domain Number - Region: 43-71
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00497
Family CRAL/TRIO N-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI106903
Sequence length 204
Comment (Nematostella vectensis)
Sequence
MTVEEFECTLCCRLFYNPVTTPCGHVFCRACLNRSLDHRPGCPICRSSLTQFLAARKENV
TVAIEMLLKTFFPKDYEDRKLQHEEDMAMLASNTSEEIPVFVCTLAFPLIPCPLHIFEPR
YRLMVRQCMESGARQFGMCMYDDEHDFSEFGTMLEVREVRYLPDGRSFVDTVGGRRFKVL
SRGMRDGYSVARVEWIQDVPVSEE
Download sequence
Identical sequences A7S6X9
jgi|Nemve1|106903|e_gw.84.73.1 45351.JGI106903 XP_001632569.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]