SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI237539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI237539
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Core binding factor beta, CBF 1.44e-51
Family Core binding factor beta, CBF 0.00000515
Further Details:      
 
Weak hits

Sequence:  45351.JGI237539
Domain Number - Region: 123-165
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0209
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI237539
Sequence length 176
Comment (Nematostella vectensis)
Sequence
MPRVVPEQKQKFENDEMFRKLARESEIKYTGYRDRSHEERVVRFQTEIRDGQSNVAYVAS
GTNLTLHFPKAEDGFIRSEFLDFDREPGKVHIKSHFILNGVCIIFKGWIDLQRLDGIGYI
EYDEEKARKEDKIMRETLEQAKQRLAEFEERQRQWREEQQRKESEASTHHHRFRQN
Download sequence
Identical sequences A7SV13
XP_001624566.1.94760 jgi|Nemve1|237539|estExt_fgenesh1_kg.C_3170004 45351.JGI237539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]