SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI39186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI39186
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI39186
Sequence length 68
Comment (Nematostella vectensis)
Sequence
RLTGVSRQRRLANTRERHRVQVLNAYIDRLRHLIPLFPGEKKPSKTETVHLAALYIEHMT
EIIQNTEK
Download sequence
Identical sequences A7RYA7
jgi|Nemve1|39186|gw.46.206.1 XP_001635729.1.94760 45351.JGI39186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]