SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI6402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI6402
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.09e-17
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI6402
Sequence length 82
Comment (Nematostella vectensis)
Sequence
PAPQNGGPYCLGEGQATQSCDMGPCPVSGAWSPWSSWTFCSASCSGGTRTRLRSCSNPAP
QHGRAACQGKVGETQDCNTHPC
Download sequence
Identical sequences A7T3K6
45351.JGI6402 XP_001621557.1.94760 jgi|Nemve1|6402|gw.1034.8.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]