SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI83730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI83730
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily Histone-fold 5.09e-47
Family Nucleosome core histones 0.00000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI83730
Sequence length 126
Comment (Nematostella vectensis)
Sequence
MSGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYMAAVLEYLSA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKT
EKKAKA
Download sequence
Identical sequences A7RJM1
jgi|Nemve1|225178|fgenesh1_pg.scaffold_7542000001 jgi|Nemve1|83638|e_gw.8.263.1 jgi|Nemve1|83730|e_gw.8.2.1 jgi|Nemve1|83731|e_gw.8.256.1 jgi|Nemve1|83819|e_gw.8.3.1 jgi|Nemve1|83910|e_gw.8.4.1 XP_001618408.1.94760 XP_001640364.1.94760 XP_001640366.1.94760 XP_001640367.1.94760 XP_001640466.1.94760 XP_001640468.1.94760 45351.JGI225178 45351.JGI83638 45351.JGI83730 45351.JGI83731 45351.JGI83819 45351.JGI83910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]