SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_0414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  453591.Igni_0414
Domain Number - Region: 294-348
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00114
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_0414
Sequence length 355
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MGRRRRRFCVKCGALEAPDNPIVDGLCLKCLTEERPLFEVKSKRKLVVCPVCSSYLVDNS
WVKGTGDVEETIRMLAHRMVEEGLRPVPPAEGAELLSVEVVRRRGGKYFAEVTAEVIVKG
AKTVQTLTVPLDVEKKPCPKCLMKSGKDYDAVLQIRSESGRVTLEELRTAGELFAKAGSG
EDVVELVDQKNGLDVLLVSKEVAKRAAQLMRFNMGAKIIESYSVVGMRKDGKVRTRLTIS
VRLPKLKGGEGLLFFGEPAIFEGFNKGKFSLYLLHSDKELKLPTDEWWQLRKSGKIKYLD
EVYLKVGTVESENPLKVNVGGEVVEAEGPPDLELGEEVYVIEYKGKVYALPKEPR
Download sequence
Identical sequences A8A9J5
gi|156937208|ref|YP_001435004.1| 453591.Igni_0414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]