SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 454169.SeHA_C2531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  454169.SeHA_C2531
Domain Number 1 Region: 145-399
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.25e-56
Family D-glucarate dehydratase-like 0.002
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.84e-23
Family Enolase N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 454169.SeHA_C2531
Sequence length 401
Comment (Salmonella enterica serovar Heidelberg SL476)
Sequence
MTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIADHIATPMSKYRDYEQSRQSFGI
NVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQMLGATM
YYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLAKEMG
FIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLAHACA
PFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLSETGIDIMQPDVG
WCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTLRPQF
DPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCHLKRPYSH
Download sequence
Identical sequences B4TBF8
CP001120|CDS_2446981-2445776 gi|194451299|ref|YP_002046345.1| 454169.SeHA_C2531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]