SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 454169.SeHA_C2546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  454169.SeHA_C2546
Domain Number 1 Region: 106-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-51
Family D-glucarate dehydratase-like 0.0000000156
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.63e-27
Family Enolase N-terminal domain-like 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 454169.SeHA_C2546
Sequence length 320
Comment (Salmonella enterica serovar Heidelberg SL476)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLRDGEREGWGEISPLPGFSQETWEEAQ
TALLTWVNDWLQGSEGLPEMPSVAFGASCALAELTGVLPEAADYRAAPLCTGDPDDLVLR
LADMPGEKIAKVKVGLYEAVRDGMVVNVLLEAIPDLHLRLDANRAWTPLKAQQFAKYVNP
DYRARIAFLEEPCKTRDDSRAFARETGIAIAWDESLREADFTFEAEEGVRAVVIKPTLTG
SLDKVREQVAAAHALGLTAVISSSIESSLGLTQLARIAAWLTPGTLPGLDTLHLMQAQQI
RPWPGSALPCLKREELERLL
Download sequence
Identical sequences A0A265B884 A0A2K2Q5T1 B4TBH3
454169.SeHA_C2546 gi|525829654|ref|YP_008252803.1| gi|525818196|ref|YP_008248214.1| gi|194448981|ref|YP_002046360.1| gi|386592115|ref|YP_006088515.1| WP_001255568.1.100730 WP_001255568.1.101185 WP_001255568.1.1013 WP_001255568.1.10231 WP_001255568.1.10566 WP_001255568.1.11156 WP_001255568.1.11588 WP_001255568.1.11677 WP_001255568.1.11687 WP_001255568.1.11735 WP_001255568.1.12017 WP_001255568.1.12718 WP_001255568.1.13207 WP_001255568.1.13661 WP_001255568.1.14111 WP_001255568.1.14436 WP_001255568.1.14458 WP_001255568.1.14618 WP_001255568.1.15862 WP_001255568.1.15910 WP_001255568.1.15986 WP_001255568.1.16004 WP_001255568.1.16047 WP_001255568.1.16361 WP_001255568.1.16525 WP_001255568.1.16873 WP_001255568.1.16903 WP_001255568.1.17093 WP_001255568.1.17629 WP_001255568.1.17743 WP_001255568.1.17891 WP_001255568.1.1798 WP_001255568.1.18122 WP_001255568.1.1818 WP_001255568.1.18254 WP_001255568.1.19273 WP_001255568.1.19588 WP_001255568.1.19616 WP_001255568.1.19793 WP_001255568.1.19975 WP_001255568.1.20446 WP_001255568.1.20614 WP_001255568.1.21136 WP_001255568.1.21351 WP_001255568.1.21991 WP_001255568.1.22235 WP_001255568.1.22692 WP_001255568.1.22758 WP_001255568.1.22864 WP_001255568.1.23379 WP_001255568.1.23509 WP_001255568.1.23959 WP_001255568.1.24082 WP_001255568.1.24259 WP_001255568.1.25119 WP_001255568.1.26741 WP_001255568.1.27084 WP_001255568.1.27223 WP_001255568.1.27544 WP_001255568.1.28032 WP_001255568.1.29113 WP_001255568.1.29509 WP_001255568.1.29827 WP_001255568.1.29990 WP_001255568.1.30022 WP_001255568.1.30202 WP_001255568.1.31092 WP_001255568.1.31122 WP_001255568.1.31451 WP_001255568.1.32260 WP_001255568.1.33580 WP_001255568.1.3394 WP_001255568.1.34417 WP_001255568.1.35193 WP_001255568.1.35892 WP_001255568.1.36017 WP_001255568.1.36547 WP_001255568.1.36899 WP_001255568.1.38393 WP_001255568.1.38569 WP_001255568.1.38781 WP_001255568.1.39265 WP_001255568.1.39553 WP_001255568.1.39584 WP_001255568.1.39724 WP_001255568.1.40341 WP_001255568.1.40996 WP_001255568.1.41018 WP_001255568.1.42156 WP_001255568.1.4222 WP_001255568.1.42243 WP_001255568.1.42444 WP_001255568.1.42676 WP_001255568.1.43077 WP_001255568.1.43339 WP_001255568.1.43371 WP_001255568.1.43778 WP_001255568.1.43951 WP_001255568.1.44300 WP_001255568.1.44433 WP_001255568.1.44933 WP_001255568.1.45145 WP_001255568.1.45434 WP_001255568.1.45582 WP_001255568.1.45622 WP_001255568.1.45848 WP_001255568.1.46278 WP_001255568.1.46434 WP_001255568.1.47008 WP_001255568.1.47579 WP_001255568.1.49113 WP_001255568.1.49686 WP_001255568.1.50404 WP_001255568.1.50576 WP_001255568.1.50999 WP_001255568.1.51066 WP_001255568.1.51224 WP_001255568.1.51831 WP_001255568.1.52170 WP_001255568.1.52336 WP_001255568.1.52692 WP_001255568.1.52866 WP_001255568.1.52949 WP_001255568.1.53272 WP_001255568.1.53905 WP_001255568.1.54526 WP_001255568.1.55325 WP_001255568.1.55430 WP_001255568.1.5560 WP_001255568.1.55973 WP_001255568.1.56244 WP_001255568.1.56559 WP_001255568.1.56660 WP_001255568.1.57356 WP_001255568.1.5774 WP_001255568.1.58358 WP_001255568.1.58407 WP_001255568.1.59420 WP_001255568.1.60545 WP_001255568.1.60561 WP_001255568.1.60772 WP_001255568.1.61201 WP_001255568.1.62020 WP_001255568.1.6209 WP_001255568.1.62257 WP_001255568.1.63797 WP_001255568.1.64018 WP_001255568.1.64387 WP_001255568.1.64894 WP_001255568.1.64920 WP_001255568.1.65269 WP_001255568.1.65940 WP_001255568.1.65956 WP_001255568.1.66049 WP_001255568.1.66330 WP_001255568.1.66678 WP_001255568.1.67100 WP_001255568.1.67235 WP_001255568.1.6739 WP_001255568.1.67942 WP_001255568.1.68401 WP_001255568.1.68477 WP_001255568.1.69001 WP_001255568.1.6904 WP_001255568.1.69151 WP_001255568.1.69359 WP_001255568.1.6954 WP_001255568.1.69758 WP_001255568.1.70488 WP_001255568.1.70580 WP_001255568.1.70959 WP_001255568.1.71023 WP_001255568.1.71363 WP_001255568.1.71636 WP_001255568.1.71798 WP_001255568.1.72403 WP_001255568.1.72728 WP_001255568.1.73125 WP_001255568.1.73461 WP_001255568.1.73847 WP_001255568.1.745 WP_001255568.1.76327 WP_001255568.1.77177 WP_001255568.1.77267 WP_001255568.1.77414 WP_001255568.1.77710 WP_001255568.1.78372 WP_001255568.1.78838 WP_001255568.1.79734 WP_001255568.1.80741 WP_001255568.1.81305 WP_001255568.1.81320 WP_001255568.1.81328 WP_001255568.1.81528 WP_001255568.1.81735 WP_001255568.1.81760 WP_001255568.1.82192 WP_001255568.1.82232 WP_001255568.1.82464 WP_001255568.1.84291 WP_001255568.1.84397 WP_001255568.1.85568 WP_001255568.1.86043 WP_001255568.1.86173 WP_001255568.1.8671 WP_001255568.1.87695 WP_001255568.1.87899 WP_001255568.1.8792 WP_001255568.1.88957 WP_001255568.1.88980 WP_001255568.1.89114 WP_001255568.1.89119 WP_001255568.1.89657 WP_001255568.1.89765 WP_001255568.1.89817 WP_001255568.1.9002 WP_001255568.1.91056 WP_001255568.1.91179 WP_001255568.1.91621 WP_001255568.1.92165 WP_001255568.1.92893 WP_001255568.1.93059 WP_001255568.1.93339 WP_001255568.1.93937 WP_001255568.1.94655 WP_001255568.1.95277 WP_001255568.1.95388 WP_001255568.1.95691 WP_001255568.1.95939 WP_001255568.1.96004 WP_001255568.1.96162 WP_001255568.1.9674 WP_001255568.1.97047 WP_001255568.1.97143 WP_001255568.1.97297 WP_001255568.1.97477 WP_001255568.1.97487 WP_001255568.1.97631 WP_001255568.1.9799 WP_001255568.1.98170 WP_001255568.1.9826 WP_001255568.1.98314 WP_001255568.1.99626 ABEL01000004|CDS_319647-318685 ABFH02000001|CDS_2716560-2717522 CP001120|CDS_2461561-2460599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]