SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455434.TPASS_0939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455434.TPASS_0939
Domain Number 1 Region: 804-1182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.15e-126
Family PFOR PP module 0.00000001
Further Details:      
 
Domain Number 2 Region: 424-675
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.16e-78
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000326
Further Details:      
 
Domain Number 3 Region: 5-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1e-71
Family PFOR Pyr module 0.0000000406
Further Details:      
 
Domain Number 4 Region: 261-421
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.28e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.000011
Further Details:      
 
Domain Number 5 Region: 672-842
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.91e-21
Family Ferredoxin domains from multidomain proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455434.TPASS_0939
Sequence length 1184
Comment (Treponema pallidum SS14)
Sequence
MSEKNLVMMDGNTAVGHVAHALSEVIAIFPITPSSPMGEIADEYSARGRTNIWGTVPTVV
ELQSEAGASGAVHGALTTGALSSTFTASQGLLLMIPNMYKIAGELTSAVFHVAARAVATS
SLSIFGDHQDVMACRQTGWALLASNSVQEAMDTAVIAHAATLEARVPFVHFFDGFRTSHE
IQKIEEVSYDVMRAMIDDELVHAHRMRGLTPEKPVVRGTAQNPDVYFQVRESVNRYYAVA
PSIVQKAMDRYAALTGRQYRLFDYYGAPDAEKVIVMIGSGSEAVEETVDVLNAQGGKCGL
VKVRLYRPFSAECFVNALPKTVQAIAVLDRTKEPGSLGEPLYEDVRTAIGQMQSQKKCPF
THYPLVLGGRYGLGSKEFTPAMAKGVFDNLSGKKIPNFSVGIEDDVTFSSVDFDPNFQLD
DQDVCQAVFYGLGSDGTVGANKNSIKIIGEATDNNAQAYFAYDSKKSGGFTISHLRFGKQ
KIRKPYLITQADFVACHKFTYLETFDMLKTLKRGGTFLLNAPYSEHEVWHHIPIEVQRQI
IEKEVKFYVIDAISIAQKAGMGTRINVVMQTAFFKIFGILPEAEAIDLIKKFIQKAYGKK
GGEVVQRNITTIDMALAGVGLVEYPGVAGSLVTRRPAMSSDAPEFVQSVLGTIALNQGDS
LGVSALPEDGTYPTGTTQYEKRCIAETIPIWDPSVCIQCGQCAMVCPHAVIRMKAYDGKE
LEHAPSKFASCDYKGKEFGEAKFTIQVSPEDCTGCGLCVQQCPAKNKADPTRKAINMESF
SKHRAVESENWAFFVKLPDPEAKKLNLSLPKGASMKRPLFEFSGACPGCGETPYIRLMTQ
IVGDRAIIANATGCSSIYGGNLPTTPYTTRPDGRGPAWSNSLFEDAAEFGFGMRVTSDKL
AEYAREVGRKLQEKGVAADLFASIFSNQQADDVAVEEQRAYVNQLKKVLSESTEPLAKEM
LSLVDHLIKRSVWIFGGDGWAYDIGYGGLDHVLASGRNITVLVMDTEVYSNTGGQMSKAT
PIGAVAKFAAAGKEISKKDIGLMAMSYGYVYVARVAMGANMSQVVKAFREAESYDGPSLI
VAYSHCISHGIDMSKGMINQKEAVACGLWPLYRYDPRRIAEGKNPFQLDSKEPDFKLADF
MYKEVRFKTLKNANPERAEMLLKRAEEKARRQWQEYKYLADRPF
Download sequence
Identical sequences A0A0A7X4K1 A0A0H3BK07 H6KVL3 O83909
gi|378974525|ref|YP_005223133.1| gi|488658370|ref|YP_007936755.1| gi|378982434|ref|YP_005230741.1| gi|408502786|ref|YP_006870230.1| WP_010882382.1.101681 WP_010882382.1.10609 WP_010882382.1.11013 WP_010882382.1.13630 WP_010882382.1.177 WP_010882382.1.22706 WP_010882382.1.24110 WP_010882382.1.24144 WP_010882382.1.26337 WP_010882382.1.26670 WP_010882382.1.28216 WP_010882382.1.31174 WP_010882382.1.34567 WP_010882382.1.35526 WP_010882382.1.35589 WP_010882382.1.37724 WP_010882382.1.38137 WP_010882382.1.38252 WP_010882382.1.38852 WP_010882382.1.39803 WP_010882382.1.41302 WP_010882382.1.42739 WP_010882382.1.42752 WP_010882382.1.43796 WP_010882382.1.44774 WP_010882382.1.45335 WP_010882382.1.49513 WP_010882382.1.50901 WP_010882382.1.51333 WP_010882382.1.6132 WP_010882382.1.61389 WP_010882382.1.63356 WP_010882382.1.72815 WP_010882382.1.73546 WP_010882382.1.74079 WP_010882382.1.78381 WP_010882382.1.79283 WP_010882382.1.82112 WP_010882382.1.89996 WP_010882382.1.90600 WP_010882382.1.90779 WP_010882382.1.92130 WP_010882382.1.96085 WP_010882382.1.98226 WP_010882382.1.98956 WP_010882382.1.99137 WP_010882382.1.99367 gi|384422428|ref|YP_005631787.1| gi|15639924|ref|NP_219375.1| gi|378975582|ref|YP_005224192.1| gi|378973459|ref|YP_005222065.1| 243276.TP0939 455434.TPASS_0939 gi|189026162|ref|YP_001933934.1| gi|512444378|ref|YP_008119657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]