SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455488.A2cp1_0055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455488.A2cp1_0055
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.15e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 455488.A2cp1_0055
Sequence length 162
Comment (Anaeromyxobacter dehalogenans 2CP 1)
Sequence
MPSRTVNVVVAGLGGQGVIKASEILADTAFRAGLDVKKAEVHGMSQRGGSVTTDVRFGAE
VLSPMVPAGEADFLLVLAPSELEVTRPLLRPGGLLIPPDAVDEARLPNRRSLNVALLGLL
SHHLELDEAHWLAAIHAALPERLHAVNDAAFRLGRETAAAAR
Download sequence
Identical sequences B8J7S3
455488.A2cp1_0055 WP_012631508.1.98204 gi|220915177|ref|YP_002490481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]