SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455488.A2cp1_0887 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  455488.A2cp1_0887
Domain Number - Region: 44-86
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0628
Family NfeD domain-like 0.011
Further Details:      
 
Domain Number - Region: 182-252
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0857
Family Anticodon-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 455488.A2cp1_0887
Sequence length 271
Comment (Anaeromyxobacter dehalogenans 2CP 1)
Sequence
MRRLSVVLLSALAVAGCKKQQPPPPQQPAAAQPAGAPAAAPVAGKVLERLDAPPYVYLKL
QTASGEAWAAVPQSDVKVGAEVSIVGAMPMNGFESKTLQRKFDVVYFGTLGGGEAAAAPA
GMPGMGGAAPAGMPPGMGGGMGGGAQPDMAAQHAAAAAGPTEVGEVKVPKASGTDARTVA
EVHAQKVTLKEKPVTIRGKVVKYNEGIMGKNWLHLRDGSGTAGKDNDLTVTTTDRTSVGE
VVTVKGTVRVDKDFGAGYAYPVIVEDAKVAK
Download sequence
Identical sequences B8JEB3
WP_012632245.1.98204 gi|220916001|ref|YP_002491305.1| 455488.A2cp1_0887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]