SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455488.A2cp1_0931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455488.A2cp1_0931
Domain Number 1 Region: 76-138
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000915
Family NfeD domain-like 0.0095
Further Details:      
 
Weak hits

Sequence:  455488.A2cp1_0931
Domain Number - Region: 5-81
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.000903
Family ABC transporter transmembrane region 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 455488.A2cp1_0931
Sequence length 140
Comment (Anaeromyxobacter dehalogenans 2CP 1)
Sequence
MDWWMWVLAGIGLLVVELVTPGGLFALFFGVGALVVAPAAAAGLGRVGQWLLFTAVSLAL
LATLRRRLQDRLSRRPGGAVDSLVGEEVVLIGDVPAGGEGPAELRGVPWRARAVGGDALR
AGQRCRVERVEGVLLWVRAA
Download sequence
Identical sequences B8JEF6
WP_012632286.1.98204 gi|220916044|ref|YP_002491348.1| 455488.A2cp1_0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]