SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455488.A2cp1_1590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455488.A2cp1_1590
Domain Number 1 Region: 47-220
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.11e-29
Family Biotin dependent carboxylase carboxyltransferase domain 0.074
Further Details:      
 
Domain Number 2 Region: 408-464
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000785
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 455488.A2cp1_1590
Sequence length 471
Comment (Anaeromyxobacter dehalogenans 2CP 1)
Sequence
MRLGEIARATRSAVPRRARAALPLLCAGLLAAGAAARATGAAAPPASPAARPARVLSATV
KGPITGGTVEYLEAALARARTGAFAALVVTLDTPGGQLDATREIVQAMLATEVPVIVWVG
PAGARAGSAGVFLTLAADVAAMHPTSNIGAAHPVTGAGRDVAEEAGKDMAKKVENDTAAF
ARSVAAARGRNADWAEKAVRESVSVTAEEALRLKVADLVAADLSEVLAKADGRKVGQGAS
ARALRVAGAAIEPYEPTVRQRLLGFLADPNVMAILMLVGMLGIAVEFYHPGMIFPGAAGG
FCLFLAFLAMRVIPVNVGAVILLLTGVGLLVAEAYVTAHGLAGLAGAACLVLGTLFFVNT
SAPGDWFDPGALRLSPWVIWPTPAALAVLLAFMAWNIARVRRAPLRLGAPGLVGAAGEAL
SEIGPAAGEAFVHGEYWQARSAAPIPSGAAVRVVAVEGLTVTVVAAAPGKG
Download sequence
Identical sequences B8J579
WP_012632866.1.98204 455488.A2cp1_1590 gi|220916696|ref|YP_002492000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]