SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_2468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_2468
Domain Number 1 Region: 78-138
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000772
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_2468
Sequence length 145
Comment (Streptomyces griseus NBRC 13350)
Sequence
MPWFAWLLAAAALGAAEFFTLTLVFGLLAGAALVAAVVAGVGVGLLGQLVALGLAAVAGL
ALVRPVALRQMTQGPLTYEGSDALIGKRAEVVQEVTATHGLIKISGEEWSARALDENLVI
PVGALVDVMEIEGATAVVYPRELLP
Download sequence
Identical sequences B1W2D3
WP_012379221.1.20467 WP_012379221.1.29035 WP_012379221.1.58927 WP_012379221.1.60218 WP_012379221.1.6712 WP_012379221.1.9539 WP_012379221.1.97807 455632.SGR_2468 gi|182436261|ref|YP_001823980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]