SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_2715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_2715
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000199
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_2715
Sequence length 208
Comment (Streptomyces griseus NBRC 13350)
Sequence
MSFGDPNNPYGQQPGQPPQGPPQGQPGYGYPQQAPQGVPPQGYGYPQQQPGQPYGAYPQQ
PGHGGQQPGYGGGMPQLAHWGLRAGGLIIDGLVVGVPYLILGGIGGAMGDSGGAIIALLG
FVALIGLVIWQLYQEGTTGQTIGKKAVGIRLLREADGRPLGFGMAFVRRLAHFLDSIACY
IGWLWPLWDEKKQTFADKVCSSVVVKAN
Download sequence
Identical sequences B1W3N8 G0PV28
gi|182436508|ref|YP_001824227.1| 455632.SGR_2715 WP_003966844.1.20467 WP_003966844.1.29035 WP_003966844.1.51792 WP_003966844.1.58927 WP_003966844.1.60218 WP_003966844.1.6712 WP_003966844.1.9539 WP_003966844.1.97807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]