SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_2929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_2929
Domain Number 1 Region: 269-537
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.32e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 2 Region: 49-269
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.62e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 3 Region: 551-652
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000895
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_2929
Sequence length 654
Comment (Streptomyces griseus NBRC 13350)
Sequence
MTSQVSSAAEQAEEANDAVLGGQRAPLSGTTGTTGSDGKEIRRLDRVIIRFAGDSGDGMQ
LTGDRFTSETASFGNDLSTLPNFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLV
AMNPAALKANIDDVPRGAEIIVNTDEFTKRPMAKVGYATSPLEDGSLEAYNVHAVPLTTL
TLEALKEFGLPRKEAERSKNMFALGLLSWMYHRPTESTEAFLRQKFAKKPQIAEANVAAF
RAGWNFGETTEDFAVSYEVAPASQAFPTGTYRNISGNLALSYGLIAAGQLAELPLYLGSY
PITPASDILHELSRHKNFGVRTFQAEDEIAGIGAALGAAFGGALGITTTSGPGVALKSET
IGLAVSLELPLLIIDIQRGGPSTGLPTKTEQADLLQAMYGRNGEAPVPIVAPRTPADCFD
AAIEAARIALTYRTPVFLLSDGYLANGSEPWRIPETSTLPDLKTPFATGPNHTLADGTEV
FWPYKRDPQTLARPWAVPGTAGLEHRIGGIEKQDGTGNISYDPANHDFMVRTRQAKIDGI
EVPDLEVDDPAEARTLVLGWGSTYGPITAAVRRLRAAGAPIAQAHLRHLNPFPKNLGEVL
KRYDKVVVPEMNLGQLALLLRAKYLVDAHSYNQVNGMPFKAEQLATALKEAIDA
Download sequence
Identical sequences B1W4W4
WP_012379522.1.20467 WP_012379522.1.58927 WP_012379522.1.60218 WP_012379522.1.6712 gi|182436722|ref|YP_001824441.1| 455632.SGR_2929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]