SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_5699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_5699
Domain Number 1 Region: 84-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000131
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_5699
Sequence length 152
Comment (Streptomyces griseus NBRC 13350)
Sequence
MTHRQSYDDHVDIDAWVWWLIGAVGLGIPLVLTAMPEFGMFAVGAVAASAVAALGGGIVA
QVLVFVLVSVALVAVVRPIAARHRAGQTGHASGIDALKGRQAVVLEQVTASGGRIKLAGE
VWSARTLDSDQVFDPGSQVDVVDIDGATAVVM
Download sequence
Identical sequences B1W1Y1 G0Q3Q8
gi|182439492|ref|YP_001827211.1| 455632.SGR_5699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]