SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g002780.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb01g002780.1
Domain Number 1 Region: 39-123
Classification Level Classification E-value
Superfamily TSP9-like 0.00000000000000392
Family TSP9-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g002780.1
Sequence length 125
Comment (Sorghum bicolor)
Sequence
MASVAFGSTVAAAVAPTSGRTRPARRSVLAVPPAATRGGPAPAKEEKGLGEIIFGFIFKK
DQLVETDPLLNKVAGASAAASSRAKPPPRGAATTSGKKAAAADDGGSGGGFNLPGLGGFF
AKKSS
Download sequence
Identical sequences 4558.Sb01g002780.1 XP_002466170.1.57931 jgi|Sorbi1|5028034|Sb01g002780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]