SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g004260.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g004260.1
Domain Number 1 Region: 81-113
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000419
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 2 Region: 151-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000209
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g004260.1
Sequence length 267
Comment (Sorghum bicolor)
Sequence
MESEGNAAAAGAGAGAGAGNWEAPNGVIVLPAGSAAPRFLQQEPHYLRRKREMEREQQDA
EAAGADPGVLGLDLRQPPEKVYYKTRLCEKFEAGKCAYEDGCTFAHGFDELRPPLPVPTA
LIRRRSPLRPRSSSPGGAAADGSQVSGGYLRVCFEFRDTGACHRGDRCAFAHASVAADMP
FPGGPRSVEHALRNASPYVKAYSSPGSAASAHRSSSTTSSFAPSSTRAVPSIPADAAGEG
RRRKVTRLELLSRKKTSGIYGDWPGQE
Download sequence
Identical sequences C5XND4
jgi|Sorbi1|5035155|Sb03g004260 XP_002455095.1.57931 4558.Sb03g004260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]