SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g006670.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g006670.1
Domain Number 1 Region: 198-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.3e-50
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 78-199
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.53e-21
Family Enolase N-terminal domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g006670.1
Sequence length 439
Comment (Sorghum bicolor)
Sequence
MDPSLSSSPLRLSATPAGPGATLTTPKPTLVAAAGPGRQPTTTTTCLRAISPSPSPPTPV
ESFGFDALKETFSVDVAAADARPLDVPLAAPFTIASSRLVAVSNVAVRVELRSGAVGWGE
APVLPSVTAEDQPAALDAAGRACAALEDASAAPLGALLQDVASVLPGHAFASARAGVEMA
LIDAVANSIRIPLWRLFGGASDSVTTDITIPIVTPNEAAQLAAKYRGQGFQTLKLKVGKN
LNSDIEVLKAIRLVHPDCSFILDANEGYTANQAIEVLDRLNEMGVTPVLFEQPVHRDDWD
GLRDVSSVAMEKYKVAVAADESCRSLLDAQKIIQGNLAHVINIKLAKLGILGALEIIDAA
RKANISLMIGGMVETRIAMGFAGHLAAGLGCFSFVDLDTPLLLSEDPVYGGYEAFGPLYK
FTNARGHGGFLHLDNDASK
Download sequence
Identical sequences 4558.Sb03g006670.1 jgi|Sorbi1|5052709|Sb03g006670 XP_002455229.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]