SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g022720.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4558.Sb06g022720.1
Domain Number - Region: 57-120
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0981
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g022720.1
Sequence length 125
Comment (Sorghum bicolor)
Sequence
MKAGSSKGRFLNLKAFLHAWKKLAAAETATASAAGWAQLDGDGETIPRDVPKGHTVVYVG
EELRRYVVRVSSLDHPLFRELLDRARDEYGFAAADTRLCLPCDEDMFLAVLCHVDAEREM
HRKVL
Download sequence
Identical sequences 4558.Sb06g022720.1 jgi|Sorbi1|5042197|Sb06g022720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]