SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb08g016830.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb08g016830.1
Domain Number 1 Region: 17-120
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-42
Family Nucleosome core histones 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb08g016830.1
Sequence length 136
Comment (Sorghum bicolor)
Sequence
MSSVGGRGKPKGTKSVTRSAKAGLQFPVGRIARYLKAGKYAERVGGGAPVYLSAVLEYLA
AEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIAAGGVLPNIHQTLLPKK
AGGKGKADIGSASQEF
Download sequence
Identical sequences C5YP98
XP_002443276.1.57931 4558.Sb08g016830.1 jgi|Sorbi1|5045146|Sb08g016830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]