SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb10g002460.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb10g002460.1
Domain Number 1 Region: 194-465
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.69e-112
Family Enolase 0.0000000197
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.73e-50
Family Enolase N-terminal domain-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb10g002460.1
Sequence length 470
Comment (Sorghum bicolor)
Sequence
MAVTITWVKARQIFDSRGNPTVEVDIGLSDGSYARGAVPSGASTGIYEALELRDGGSDYL
GKGVLKAVSNVNTIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAV
SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVIMAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQEFMILPTGASSFKEAMKMGVEVYHNLKSIIKKKYGQDATNVGDEG
GFAPNIQENKEGLELLKAAIEKAGYTGKVVIGMDVAASEFFSEKDKTYDLNFKEENNDGS
NKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWTTYAKLTDEIGQQVQIVGDDLLVTNPT
RVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSV
GLATGQIKTGAPCRSERLAKYNQLLRIEEELGVAAVYAGAKFRAPVEPYP
Download sequence
Identical sequences 4558.Sb10g002460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]