SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_2244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_2244
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000028
Family ScpB/YpuH-like 0.035
Further Details:      
 
Weak hits

Sequence:  456442.Mboo_2244
Domain Number - Region: 106-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0392
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_2244
Sequence length 269
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MTPDAKDPLYSILRSKREVSRLQILVEIAEHQPAVRQQEIAAKLGVTPQAISEYIRELTD
EGMVSASGRGNYEVTKAGIEWVLANAESLEAYARHIRRDIIQQVSIWTAIAADNLKAGDE
VGVFMKGGFLYAAKKPQPAMGSVVADAKKDEDVGVARLNGIIEHHEGSITICKVPRVQHG
GSRRVQLDRLRDLVKPAGLVAAVGLEASIALKAAGHKPDLFFGAREGVIEAAFHGIDCVI
VIVDEEFTDFLKRLESVGLSYAIVDLISP
Download sequence
Identical sequences A7IAJ7
456442.Mboo_2244 WP_012107818.1.2930 gi|154151783|ref|YP_001405401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]