SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456481.LEPBI_I1604 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456481.LEPBI_I1604
Domain Number 1 Region: 129-173
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000017
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 456481.LEPBI_I1604
Sequence length 174
Comment (Leptospira biflexa serovar Patoc Patoc 1 Paris )
Sequence
MNQSIIFLAMKRSKRSIHLEVHTLDLILANTPYLWILVGIILLFSEFLLPGTFVMFLGVG
AIFTGIVSRLVPMDFYSEIIVWVVSSFVSILLGGSLIKKFFKSESSVDPFVTDDFLNQIV
PVEIDVLVGRHGGKIKFQGTLWDAISKESKIPKGEYVRILSRENLTFTVEKVDS
Download sequence
Identical sequences B0SR10
456481.LEPBI_I1604 gi|183220991|ref|YP_001838987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]