SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456481.LEPBI_I1704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456481.LEPBI_I1704
Domain Number 1 Region: 143-432
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-129
Family Enolase 0.00000000402
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.96e-58
Family Enolase N-terminal domain-like 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456481.LEPBI_I1704
Sequence length 433
Comment (Leptospira biflexa serovar Patoc Patoc 1 Paris )
Sequence
MSQKDSIRSVRAREIMDSRGNPTVEVDVTLEDGSFGRAAVPSGASTGEHEAVELRDGDKK
RYGGKGVQKAVDNVNAKISKSILGLSATDQLQIDGTMIALDGTANKSKLGANAILGVSMA
VAKAAAVHAGLPLYRYIGGTFARELPVPMMNIINGGAHADNNIDFQEFMILPVSAPNFKE
ALRMGAEVFHSLKTVLKGKGLNTAVGDEGGFAPNLTSNSEAIEVILTAIEKAGYKPDLDI
KIGLDCAASEFYDEKKKKYILKAEKKPEKTAEELVEYYSNLVSKYPIITMEDGLDENDWS
GWKKLSEKLGKKIQLVGDDLFVTNIKKLAQGIDKGIGNSILIKVNQIGSLTETLSAIEMA
KKAQYTAVVSHRSGETEDATISHIAVATNSGQIKTGSLSRTDRIAKYNELLRIEEELGKN
ATYSGVNTFYNLR
Download sequence
Identical sequences B0S8S8 B0SRL5
gi|183221090|ref|YP_001839086.1| WP_012388688.1.33202 WP_012388688.1.95533 355278.LBF_1652 456481.LEPBI_I1704 gi|189911182|ref|YP_001962737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]