SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456481.LEPBI_I3080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456481.LEPBI_I3080
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 456481.LEPBI_I3080
Sequence length 114
Comment (Leptospira biflexa serovar Patoc Patoc 1 Paris )
Sequence
MEINLKKNADAFVISISGSLDIYTSLDFKNFLETNIPSQPSGNLHVIINLEKLNYIDSSG
IGMLIKQLNYVQELQGKFSIANMKPAIEKVFKVAGLTSYFQTIGEDEYREKYAV
Download sequence
Identical sequences B0SPP0
WP_012390004.1.33202 WP_012390004.1.95533 gi|183222426|ref|YP_001840422.1| gi|189912466|ref|YP_001964021.1| 355278.LBF_2971 456481.LEPBI_I3080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]