SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_0024 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_0024
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_0024
Sequence length 198
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MDNTTKIALAGEGGQGVQSVADIFAEAANDTEKQALYIPNFGVEQRGGVSVAYVQIAEEQ
IGSPKFTKGDIVVALSGRAVDRTEKYVGENTIFVYDSSLIDMPEERENEGSGLGQAKKIL
GIPANDIAKQEFHPRVFNIMVLGAVIELSKVLPPEAVKNAIEKKLQRKFEQNPKLREMNM
EAFDRGMELAKESAEEKI
Download sequence
Identical sequences B2A311
WP_012446514.1.10671 457570.Nther_0024 gi|188584666|ref|YP_001916211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]