SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_1193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_1193
Domain Number 1 Region: 38-208
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.19e-30
Family Clp protease, ClpP subunit 0.061
Further Details:      
 
Domain Number 2 Region: 383-446
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000536
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_1193
Sequence length 458
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MVRKNFNIFCSFICVLLIFSGLFIHFEEVQAQSLADTGEKTVYQVPVEGNIERGLSAFLN
RAFESAQEENADLIVLDINTPGGALDASFEIKDLIVNEEIPVYAFVNSQAISAGSYLALA
SDEIYMRPTGTMGAAEARMGTEVADEKVMSVWETEMRTVAKERDRDPDIAAAMVRREMEI
EGLVSENQLLTLSAEEAKEHGMAEGIVNNYDELLEKTGYEGANIVEYPMEWAERMARFFT
SPAVASILLTLGMAGLVIELSSPGLGLPGLVGLLCFGLFFGGHIFAGLAGYEVLLFFIVG
IILLLIEAIAAGFGVMGLAGIVSFGFAIVISAESTEQGLMMLLYSLLGTIIVLVIAFRYF
VRSRFWDRIILNHSESKDQGYVGTNTEYKNLVGESGVTEGPLRPAGTAQISGERIDVISE
GGYIPEGTPVQVSKVEGSRVIVKEIKSEESDQKEEDTE
Download sequence
Identical sequences B2A1N9
gi|188585819|ref|YP_001917364.1| 457570.Nther_1193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]