SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_1533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  457570.Nther_1533
Domain Number - Region: 1-59
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0539
Family D-glucarate dehydratase-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_1533
Sequence length 62
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MPETGIGASFMLALGTYSNFAYPSDVADSRKWFGNNNDLKELTMTGEGKIHYLDEIGIGK
IN
Download sequence
Identical sequences B2A409
gi|188586154|ref|YP_001917699.1| 457570.Nther_1533 WP_012447981.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]