SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_2015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_2015
Domain Number 1 Region: 139-425
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.12e-127
Family Enolase 0.000000016
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.38e-52
Family Enolase N-terminal domain-like 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_2015
Sequence length 427
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MSMIEEIYAREIFDSRGNPTVEVELYTESGAYGFARVPSGASTGVHEALELRDGEDRFGG
KGVRKACSKVNEEIGPNLVGMDVTFQSAIDRALLELDGTDNKENLGANAMLGVSLAAARA
SAEFLGLPLYQVLGGVSSSTLPIPQMNILNGGEHADNNVDIQEFMIMPIRANNFQHAMRM
GVEIFHALKNVLKDEGLSTSVGDEGGFAPDLKSNKEALEYIITAIEKVGYKPGEQVMLAI
DAAASELYQGDKYHLEGEGKSLTADEMIDLYQDLVENYPIISIEDGLSEDDWEGWKKMTE
KFQGKIQLVGDDLFVTNTDRLTRGIKEDIANSILIKLNQIGTVTETLEAIELAKKNGYTS
VISHRSGETDDPFIADLAVATNAGQIKTGAPSRMDRVAKYNQLIRISEELYGVSRYPGMG
SFYNLEV
Download sequence
Identical sequences B2A6Z1
gi|188586625|ref|YP_001918170.1| 457570.Nther_2015 WP_012448439.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]