SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 458233.MCCL_0878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458233.MCCL_0878
Domain Number 1 Region: 197-456
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-72
Family Pyruvate oxidase and decarboxylase Pyr module 0.096
Further Details:      
 
Domain Number 2 Region: 3-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0046
Further Details:      
 
Domain Number 3 Region: 469-575
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.85e-16
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 458233.MCCL_0878
Sequence length 577
Comment (Macrococcus caseolyticus JCSC5402)
Sequence
MKTQISWKVGGQQGEGIESTGEIFSTALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTP
VYAISDDLDILVAFDQETIDLNYHELTAEGIILADSKFDPVAPEDYNGVFISMGFTEIAK
ELGTALMKNMVAVGATANLIGADLKHFEVLVDDLFAKKGEKICTLNKEALHKGYAEIESH
SELTVDYKLEPSTEEGHLFMIGNEAISLGALAGGARFMAAYPITPASEIMEYMIDKLPRF
GGTVIQTEDEIAAAVMAIGVNYAGVRAFTASSGPGLSLMMEAIGLSGMTEQPLVIVNTMR
GGPSTGLPTKQEQSDLMQMIYGTHGEIPKIVLAPTTAEDAFYLTNEAFNLAEVYQCPVII
LSDLQLSLGKQTVPVLDYNKINIDRGSLVTDIAPTEDKAYFKRYAVTDNGISPRTIPGVK
NGIHHVTGVEHNEEGKPSESPVNRAKQMEKRMRKLEQLKITEPVVYNAHHEAADVLVIGY
ISTYGAIDEAIHRVEGKVNHLHMKQLHPFPTEEVQQAIDKAKKVIVVEHNFNGQLGQIIK
MNTNHQGKMIQMSKYDGTPYLPHEIEEKINATLKELI
Download sequence
Identical sequences B9EBH4
458233.MCCL_0878 gi|222151127|ref|YP_002560281.1| WP_012656785.1.50991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]